eF-site ID 6gfo-D
PDB Code 6gfo
Chain D

click to enlarge
Title cyanobacterial GAPDH with full-length CP12
Classification PHOTOSYNTHESIS
Compound Glyceraldehyde-3-phosphate dehydrogenase
Source (Q8DHX3_THEEB)
Sequence D:  SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSD
PRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVS
DRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKK
VLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCL
APIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRR
ARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTP
NVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSE
LELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEW
GYSQRVLDLAEHMAAHWA
Description (1)  Glyceraldehyde-3-phosphate dehydrogenase (E.C.1.2.1.-), CP12 polypeptide


Functional site

1) chain D
residue 8
type
ligand
sequence G
description binding site for residue NAD D 1001
source : AC5

2) chain D
residue 10
type
ligand
sequence G
description binding site for residue NAD D 1001
source : AC5

3) chain D
residue 11
type
ligand
sequence R
description binding site for residue NAD D 1001
source : AC5

4) chain D
residue 12
type
ligand
sequence I
description binding site for residue NAD D 1001
source : AC5

5) chain D
residue 35
type
ligand
sequence N
description binding site for residue NAD D 1001
source : AC5

6) chain D
residue 36
type
ligand
sequence D
description binding site for residue NAD D 1001
source : AC5

7) chain D
residue 37
type
ligand
sequence T
description binding site for residue NAD D 1001
source : AC5

8) chain D
residue 81
type
ligand
sequence R
description binding site for residue NAD D 1001
source : AC5

9) chain D
residue 99
type
ligand
sequence A
description binding site for residue NAD D 1001
source : AC5

10) chain D
residue 100
type
ligand
sequence T
description binding site for residue NAD D 1001
source : AC5

11) chain D
residue 101
type
ligand
sequence G
description binding site for residue NAD D 1001
source : AC5

12) chain D
residue 103
type
ligand
sequence F
description binding site for residue NAD D 1001
source : AC5

13) chain D
residue 123
type
ligand
sequence T
description binding site for residue NAD D 1001
source : AC5

14) chain D
residue 124
type
ligand
sequence A
description binding site for residue NAD D 1001
source : AC5

15) chain D
residue 154
type
ligand
sequence C
description binding site for residue NAD D 1001
source : AC5

16) chain D
residue 317
type
ligand
sequence N
description binding site for residue NAD D 1001
source : AC5

17) chain D
residue 321
type
ligand
sequence Y
description binding site for residue NAD D 1001
source : AC5

18) chain D
residue 191
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence D
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

19) chain D
residue 193
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence S
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

20) chain D
residue 7-13
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NGFGRIG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

21) chain D
residue 35-37
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NDT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

22) chain D
residue 80-81
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence DR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

23) chain D
residue 99-103
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence ATGVF
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

24) chain D
residue 123-124
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TA
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

25) chain D
residue 153-154
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence SC
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

26) chain D
residue 181
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence H
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

27) chain D
residue 184-185
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

28) chain D
residue 317-318
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NE
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

29) chain D
residue 321
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence Y
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001


Display surface

Download
Links