eF-site ID 6gfo-C
PDB Code 6gfo
Chain C

click to enlarge
Title cyanobacterial GAPDH with full-length CP12
Classification PHOTOSYNTHESIS
Compound Glyceraldehyde-3-phosphate dehydrogenase
Source (Q8DHX3_THEEB)
Sequence C:  SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSD
PRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVS
DRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKK
VLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCL
APIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRR
ARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTP
NVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSE
LELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEW
GYSQRVLDLAEHMAAHWA
Description (1)  Glyceraldehyde-3-phosphate dehydrogenase (E.C.1.2.1.-), CP12 polypeptide


Functional site

1) chain C
residue 8
type
ligand
sequence G
description binding site for residue NAD C 1001
source : AC3

2) chain C
residue 9
type
ligand
sequence F
description binding site for residue NAD C 1001
source : AC3

3) chain C
residue 10
type
ligand
sequence G
description binding site for residue NAD C 1001
source : AC3

4) chain C
residue 11
type
ligand
sequence R
description binding site for residue NAD C 1001
source : AC3

5) chain C
residue 12
type
ligand
sequence I
description binding site for residue NAD C 1001
source : AC3

6) chain C
residue 35
type
ligand
sequence N
description binding site for residue NAD C 1001
source : AC3

7) chain C
residue 36
type
ligand
sequence D
description binding site for residue NAD C 1001
source : AC3

8) chain C
residue 37
type
ligand
sequence T
description binding site for residue NAD C 1001
source : AC3

9) chain C
residue 81
type
ligand
sequence R
description binding site for residue NAD C 1001
source : AC3

10) chain C
residue 99
type
ligand
sequence A
description binding site for residue NAD C 1001
source : AC3

11) chain C
residue 100
type
ligand
sequence T
description binding site for residue NAD C 1001
source : AC3

12) chain C
residue 101
type
ligand
sequence G
description binding site for residue NAD C 1001
source : AC3

13) chain C
residue 123
type
ligand
sequence T
description binding site for residue NAD C 1001
source : AC3

14) chain C
residue 124
type
ligand
sequence A
description binding site for residue NAD C 1001
source : AC3

15) chain C
residue 154
type
ligand
sequence C
description binding site for residue NAD C 1001
source : AC3

16) chain C
residue 317
type
ligand
sequence N
description binding site for residue NAD C 1001
source : AC3

17) chain C
residue 321
type
ligand
sequence Y
description binding site for residue NAD C 1001
source : AC3

18) chain C
residue 184
type
ligand
sequence T
description binding site for residue SO4 C 1002
source : AC4

19) chain C
residue 186
type
ligand
sequence D
description binding site for residue SO4 C 1002
source : AC4

20) chain C
residue 199
type
ligand
sequence R
description binding site for residue SO4 C 1002
source : AC4

21) chain C
residue 235
type
ligand
sequence R
description binding site for residue SO4 C 1002
source : AC4

22) chain C
residue 191
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence D
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_B_1001

23) chain C
residue 193
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence S
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_B_1001

24) chain C
residue 7-13
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NGFGRIG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

25) chain C
residue 35-37
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NDT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

26) chain C
residue 80-81
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence DR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

27) chain C
residue 99-104
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence ATGVFT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

28) chain C
residue 123-124
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TA
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

29) chain C
residue 153-154
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence SC
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

30) chain C
residue 181
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence H
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

31) chain C
residue 184-185
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

32) chain C
residue 317-318
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NE
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001

33) chain C
residue 321
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence Y
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_C_1001


Display surface

Download
Links