eF-site ID 6gfo-A
PDB Code 6gfo
Chain A

click to enlarge
Title cyanobacterial GAPDH with full-length CP12
Classification PHOTOSYNTHESIS
Compound Glyceraldehyde-3-phosphate dehydrogenase
Source (Q8DHX3_THEEB)
Sequence A:  SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSD
PRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVS
DRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKK
VLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCL
APIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRR
ARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTP
NVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSE
LELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEW
GYSQRVLDLAEHMAAHWA
Description (1)  Glyceraldehyde-3-phosphate dehydrogenase (E.C.1.2.1.-), CP12 polypeptide


Functional site

1) chain A
residue 8
type
ligand
sequence G
description binding site for residue NAD A 1001
source : AC1

2) chain A
residue 9
type
ligand
sequence F
description binding site for residue NAD A 1001
source : AC1

3) chain A
residue 10
type
ligand
sequence G
description binding site for residue NAD A 1001
source : AC1

4) chain A
residue 11
type
ligand
sequence R
description binding site for residue NAD A 1001
source : AC1

5) chain A
residue 12
type
ligand
sequence I
description binding site for residue NAD A 1001
source : AC1

6) chain A
residue 35
type
ligand
sequence N
description binding site for residue NAD A 1001
source : AC1

7) chain A
residue 36
type
ligand
sequence D
description binding site for residue NAD A 1001
source : AC1

8) chain A
residue 37
type
ligand
sequence T
description binding site for residue NAD A 1001
source : AC1

9) chain A
residue 81
type
ligand
sequence R
description binding site for residue NAD A 1001
source : AC1

10) chain A
residue 99
type
ligand
sequence A
description binding site for residue NAD A 1001
source : AC1

11) chain A
residue 100
type
ligand
sequence T
description binding site for residue NAD A 1001
source : AC1

12) chain A
residue 101
type
ligand
sequence G
description binding site for residue NAD A 1001
source : AC1

13) chain A
residue 103
type
ligand
sequence F
description binding site for residue NAD A 1001
source : AC1

14) chain A
residue 123
type
ligand
sequence T
description binding site for residue NAD A 1001
source : AC1

15) chain A
residue 124
type
ligand
sequence A
description binding site for residue NAD A 1001
source : AC1

16) chain A
residue 154
type
ligand
sequence C
description binding site for residue NAD A 1001
source : AC1

17) chain A
residue 317
type
ligand
sequence N
description binding site for residue NAD A 1001
source : AC1

18) chain A
residue 321
type
ligand
sequence Y
description binding site for residue NAD A 1001
source : AC1

19) chain A
residue 7-13
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NGFGRIG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

20) chain A
residue 35-37
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NDT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

21) chain A
residue 80-81
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence DR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

22) chain A
residue 99-104
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence ATGVFT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

23) chain A
residue 123-124
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TA
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

24) chain A
residue 153-154
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence SC
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

25) chain A
residue 181
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence H
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

26) chain A
residue 184-185
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

27) chain A
residue 317-318
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NE
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

28) chain A
residue 321
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence Y
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_A_1001

29) chain A
residue 191
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence D
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001

30) chain A
residue 193
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence S
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gfo_D_1001


Display surface

Download
Links