eF-site ID 6gam-M PDB Code 6gam Chain M click to enlarge Title Structure of E14Q variant of E. coli hydrogenase-2 (as-isolated enzyme) Classification OXIDOREDUCTASE Compound Hydrogenase-2 small chain Source (MBHM_ECOLI) Sequence M:  SQRITIDPVTRIQGHLRIDCEIENGVVSKAWASGTMWRGM EEIVKNRDPRDAWMIVQRICGVCTTTHALSSVRAAESALN IDVPVNAQYIRNIILAAHTTHDHIVHFYQLSALDWVDITS ALQADPTKASEMLKGVSTWHLNSPEEFTKVQNKIKDLVAS GQLGIFANGYWGHPAMKLPPEVNLIAVAHYLQALECQRDA NRVVALLGGKTPHIQNLAVGGVANPINLDGLGVLNLERLM YIKSFIDKLSDFVEQVYKVDTAVIAAFYPEWLTRGKGAVN YLSVPEFPTDSKNGSFLFPGGYIENADLSSYRPITSHSDE YLIKGIQESAKHSWYKDEAPQAPWEGTTIPAYDGWSDDGK YSWVKSPTFYGKTVEVGPLANMLVKLAAGRESTQNKLNEI VAIYQKLTGNTLEVAQLHSTLGRIIGRTVHCCELQDILQN QYSALITNIGKGDHTTFVKPNIPATGEFKGVGFLEAPRGM LSHWMVIKDGIISNYQAVVPSTWNSGPRNFNDDVGPYEQS LVGTPVADPNKPLEVVRTIHSFDPCMACAVH Description Functional site 1) chain M residue 211 type sequence K description binding site for residue F3S T 402 source : AC8 2) chain M residue 216 type sequence Q description binding site for residue F3S T 402 source : AC8 3) chain M residue 59 type sequence R description binding site for residue SF4 T 403 source : AC9 4) chain M residue 64 type sequence C description binding site for residue FCO M 601 source : AD1 5) chain M residue 67 type sequence T description binding site for residue FCO M 601 source : AD1 6) chain M residue 68 type sequence H description binding site for residue FCO M 601 source : AD1 7) chain M residue 477 type sequence A description binding site for residue FCO M 601 source : AD1 8) chain M residue 478 type sequence P description binding site for residue FCO M 601 source : AD1 9) chain M residue 479 type sequence R description binding site for residue FCO M 601 source : AD1 10) chain M residue 482 type sequence L description binding site for residue FCO M 601 source : AD1 11) chain M residue 500 type sequence V description binding site for residue FCO M 601 source : AD1 12) chain M residue 501 type sequence P description binding site for residue FCO M 601 source : AD1 13) chain M residue 502 type sequence S description binding site for residue FCO M 601 source : AD1 14) chain M residue 549 type sequence C description binding site for residue FCO M 601 source : AD1 15) chain M residue 61 type sequence C description binding site for residue NI M 602 source : AD2 16) chain M residue 64 type sequence C description binding site for residue NI M 602 source : AD2 17) chain M residue 546 type sequence C description binding site for residue NI M 602 source : AD2 18) chain M residue 549 type sequence C description binding site for residue NI M 602 source : AD2 19) chain M residue 42 type sequence E description binding site for residue MG M 603 source : AD3 20) chain M residue 498 type sequence A description binding site for residue MG M 603 source : AD3 21) chain M residue 552 type sequence H description binding site for residue MG M 603 source : AD3 22) chain M residue 552 type SITE sequence H description Cleavage; by HybD source Swiss-Prot : SWS_FT_FI2 23) chain M residue 61 type BINDING sequence C description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 24) chain M residue 64 type BINDING sequence C description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 25) chain M residue 546 type BINDING sequence C description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 26) chain M residue 549 type BINDING sequence C description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links