eF-site ID 6g7f-V PDB Code 6g7f Chain V click to enlarge Title Yeast 20S proteasome in complex with Cystargolide B Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence V:  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPK IWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQ KSYKFPRGTTAVLKESIVNICDIQEE Description Functional site 1) chain V residue 69 type sequence Y description binding site for residue CL U 301 source : AC9 2) chain V residue 163 type sequence I description binding site for residue MG V 302 source : AD1 3) chain V residue 164 type sequence W description binding site for residue MG V 302 source : AD1 4) chain V residue 166 type sequence D description binding site for residue MG V 302 source : AD1 5) chain V residue 167 type sequence L description binding site for residue MG V 302 source : AD1 6) chain V residue 2 type sequence T description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 7) chain V residue 17 type sequence D description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 8) chain V residue 19 type sequence R description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 9) chain V residue 21 type sequence T description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 10) chain V residue 33 type sequence K description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 11) chain V residue 45 type sequence G description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 12) chain V residue 46 type sequence A description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 13) chain V residue 47 type sequence G description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 14) chain V residue 127 type sequence L description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 15) chain V residue 128 type sequence G description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 16) chain V residue 129 type sequence S description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 17) chain V residue 130 type sequence G description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 18) chain V residue 168 type sequence G description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 19) chain V residue 169 type sequence S description binding site for Di-peptide EPW V 301 and THR V 1 source : AD5 20) chain V residue 114 type sequence H description binding site for Di-peptide EPW b 201 and THR b 1 source : AD7 21) chain V residue 118 type sequence S description binding site for Di-peptide EPW b 201 and THR b 1 source : AD7 22) chain V residue 1 type catalytic sequence T description 177 source MCSA : MCSA2 23) chain V residue 17 type catalytic sequence D description 177 source MCSA : MCSA2 24) chain V residue 19 type catalytic sequence R description 177 source MCSA : MCSA2 25) chain V residue 33 type catalytic sequence K description 177 source MCSA : MCSA2 26) chain V residue 47 type catalytic sequence G description 177 source MCSA : MCSA2 27) chain V residue 129 type catalytic sequence S description 177 source MCSA : MCSA2 28) chain V residue 166 type catalytic sequence D description 177 source MCSA : MCSA2 29) chain V residue 169 type catalytic sequence S description 177 source MCSA : MCSA2

Display surface Download Links