eF-site ID 6g7f-K PDB Code 6g7f Chain K click to enlarge Title Yeast 20S proteasome in complex with Cystargolide B Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence K:  TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPF LLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAAS KILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGT RLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRS ILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKV KEEEGSFNNVIG Description Functional site 1) chain K residue 1 type sequence T description binding site for residue EPW K 301 source : AC5 2) chain K residue 20 type sequence A description binding site for residue EPW K 301 source : AC5 3) chain K residue 21 type sequence T description binding site for residue EPW K 301 source : AC5 4) chain K residue 22 type sequence A description binding site for residue EPW K 301 source : AC5 5) chain K residue 46 type sequence A description binding site for residue EPW K 301 source : AC5 6) chain K residue 47 type sequence G description binding site for residue EPW K 301 source : AC5 7) chain K residue 165 type sequence A description binding site for residue MG K 302 source : AC6 8) chain K residue 166 type sequence H description binding site for residue MG K 302 source : AC6 9) chain K residue 168 type sequence D description binding site for residue MG K 302 source : AC6 10) chain K residue 171 type sequence S description binding site for residue MG K 302 source : AC6 11) chain K residue 49 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI2 12) chain K residue 1 type ACT_SITE sequence T description Nucleophile => ECO:0000269|PubMed:9087403 source Swiss-Prot : SWS_FT_FI1 13) chain K residue 4-51 type prosite sequence LAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLG TMAGGAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. ISMkYdnGVIIAADnlgsygsllrfngve.RlipvgdntvvgisGdiSD source prosite : PS00854

Display surface Download Links