eF-site ID 6g6s-AB
PDB Code 6g6s
Chain A, B

click to enlarge
Title Crystal structure of human Acinus RNA recognition motif domain
Classification RNA BINDING PROTEIN
Compound Apoptotic chromatin condensation inducer in the nucleus
Source (ACINU_HUMAN)
Sequence A:  GSGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWI
DKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCAD
YAEQDELDYHRGLLV
B:  GKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDK
IKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYA
EQDELDYHRGL
Description (1)  Apoptotic chromatin condensation inducer in the nucleus

Display surface

Download
Links