eF-site ID 6g5k-A
PDB Code 6g5k
Chain A

click to enlarge
Title Crystal structure of the binding domain of Botulinum Neurotoxin type B in complex with human synaptotagmin 1
Classification TOXIN
Compound Botulinum neurotoxin type B
Source (SYT1_HUMAN)
Sequence A:  LNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK
LTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKND
GIQNYIHNEYTIINCMKNNSGWKISIRGNRIIWTLIDING
KTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING
KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFS
IFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYM
FNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY
IGEKFIIRRKSDDIVRKEDYIYLDFFNLNQEWRVYTYKYF
KKEEEKLFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFK
KDEESTDEIGLIGIHRFYEEYKDYFCISKWYLKEVKRKPY
NLKLGCNWQFIPKDEGWTELQ
Description (1)  Botulinum neurotoxin type B (E.C.3.4.24.69), Synaptotagmin-1

Display surface

Download
Links