eF-site ID 6g56-B
PDB Code 6g56
Chain B

click to enlarge
Title Apo-structure of the alanine racemase from Staphylococcus aureus
Classification BIOSYNTHETIC PROTEIN
Compound Alanine racemase 1
Source (ALR1_STAAM)
Sequence B:  FSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVVKA
NAYGLGSVKVARHLMENGATFFAVATLDEAIELRMHGITA
KILVLGVLPAKDIDKAIQHRVALTVPSKQWLKEAIKNISG
EQEKKLWLHIKLDTGMGRLGIKDTNTYQEVIEIIQQYEQL
VFEGVFTHFACADEPGDMTTEQYQRFKDMVNEAIKPEYIH
CQNSAGSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVH
LKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIALL
PIGYADGYLRIMQGSFVNVNGHQCEVIGRVCMDQTIVKVP
DQVKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNL
SRRLPRIYHDGDQRFVTNELLK
Description (1)  Alanine racemase 1 (E.C.5.1.1.1)


Functional site

1) chain B
residue 138
type
ligand
sequence R
description binding site for residue SO4 A 407
source : AC7

2) chain B
residue 168
type
ligand
sequence H
description binding site for residue SO4 A 407
source : AC7

3) chain B
residue 169
type
ligand
sequence F
description binding site for residue SO4 A 407
source : AC7

4) chain B
residue 171
type
ligand
sequence C
description binding site for residue SO4 A 407
source : AC7

5) chain B
residue 39
type
ligand
sequence K
description binding site for residue GOL A 409
source : AC9

6) chain B
residue 138
type
ligand
sequence R
description binding site for residue GOL A 409
source : AC9

7) chain B
residue 43
type
ligand
sequence Y
description binding site for residue SO4 B 401
source : AD1

8) chain B
residue 203
type
ligand
sequence N
description binding site for residue SO4 B 401
source : AD1

9) chain B
residue 204
type
ligand
sequence S
description binding site for residue SO4 B 401
source : AD1

10) chain B
residue 221
type
ligand
sequence G
description binding site for residue SO4 B 401
source : AD1

11) chain B
residue 222
type
ligand
sequence I
description binding site for residue SO4 B 401
source : AD1

12) chain B
residue 354
type
ligand
sequence Y
description binding site for residue SO4 B 401
source : AD1

13) chain B
residue 228
type
ligand
sequence Y
description binding site for residue SO4 B 402
source : AD2

14) chain B
residue 234
type
ligand
sequence Q
description binding site for residue SO4 B 402
source : AD2

15) chain B
residue 240
type
ligand
sequence H
description binding site for residue SO4 B 402
source : AD2

16) chain B
residue 241
type
ligand
sequence L
description binding site for residue SO4 B 402
source : AD2

17) chain B
residue 336
type
ligand
sequence R
description binding site for residue SO4 B 402
source : AD2

18) chain B
residue 183
type
ligand
sequence Y
description binding site for residue SO4 B 403
source : AD3

19) chain B
residue 187
type
ligand
sequence K
description binding site for residue SO4 B 403
source : AD3

20) chain B
residue 212
type
ligand
sequence C
description binding site for residue SO4 B 403
source : AD3

21) chain B
residue 213
type
ligand
sequence Q
description binding site for residue SO4 B 403
source : AD3

22) chain B
residue 214
type
ligand
sequence F
description binding site for residue SO4 B 403
source : AD3

23) chain B
residue 143
type
ligand
sequence D
description binding site for residue SO4 B 404
source : AD4

24) chain B
residue 144
type
ligand
sequence T
description binding site for residue SO4 B 404
source : AD4

25) chain B
residue 185
type
ligand
sequence R
description binding site for residue SO4 B 404
source : AD4

26) chain B
residue 184
type
ligand
sequence Q
description binding site for residue SO4 B 405
source : AD5

27) chain B
residue 187
type
ligand
sequence K
description binding site for residue SO4 B 405
source : AD5

28) chain B
residue 149
type
ligand
sequence E
description binding site for residue SO4 B 406
source : AD6

29) chain B
residue 152
type
ligand
sequence E
description binding site for residue SO4 B 406
source : AD6

30) chain B
residue 108
type
ligand
sequence K
description binding site for residue SO4 B 407
source : AD7

31) chain B
residue 112
type
ligand
sequence K
description binding site for residue SO4 B 407
source : AD7

32) chain B
residue 149
type
ligand
sequence E
description binding site for residue SO4 B 407
source : AD7

33) chain B
residue 142
type
ligand
sequence K
description binding site for residue SO4 B 408
source : AD8

34) chain B
residue 143
type
ligand
sequence D
description binding site for residue SO4 B 408
source : AD8

35) chain B
residue 146
type
ligand
sequence T
description binding site for residue SO4 B 408
source : AD8

36) chain B
residue 210
type
ligand
sequence M
description binding site for residue SO4 B 409
source : AD9

37) chain B
residue 211
type
ligand
sequence D
description binding site for residue SO4 B 409
source : AD9

38) chain B
residue 212
type
ligand
sequence C
description binding site for residue SO4 B 409
source : AD9

39) chain B
residue 29
type
ligand
sequence H
description binding site for residue SO4 B 410
source : AE1

40) chain B
residue 30
type
ligand
sequence P
description binding site for residue SO4 B 410
source : AE1

41) chain B
residue 31
type
ligand
sequence N
description binding site for residue SO4 B 410
source : AE1

42) chain B
residue 32
type
ligand
sequence K
description binding site for residue SO4 B 410
source : AE1

43) chain B
residue 213
type
ligand
sequence Q
description binding site for residue SO4 B 410
source : AE1

44) chain B
residue 16
type
ligand
sequence N
description binding site for residue SO4 B 411
source : AE2

45) chain B
residue 19
type
ligand
sequence A
description binding site for residue SO4 B 411
source : AE2

46) chain B
residue 53
type
ligand
sequence H
description binding site for residue SO4 B 411
source : AE2

47) chain B
residue 57
type
ligand
sequence N
description binding site for residue SO4 B 411
source : AE2

48) chain B
residue 49
type
ligand
sequence K
description binding site for residue SO4 B 412
source : AE3

49) chain B
residue 52
type
ligand
sequence R
description binding site for residue SO4 B 412
source : AE3

50) chain B
residue 76
type
ligand
sequence H
description binding site for residue SO4 B 412
source : AE3

51) chain B
residue 74
type
ligand
sequence R
description binding site for residue SO4 B 413
source : AE4

52) chain B
residue 99
type
ligand
sequence H
description binding site for residue SO4 B 413
source : AE4

53) chain B
residue 100
type
ligand
sequence R
description binding site for residue SO4 B 413
source : AE4

54) chain B
residue 124
type
ligand
sequence K
description binding site for residue SO4 B 414
source : AE5

55) chain B
residue 125
type
ligand
sequence K
description binding site for residue SO4 B 414
source : AE5

56) chain B
residue 157
type
ligand
sequence Y
description binding site for residue SO4 B 415
source : AE6

57) chain B
residue 158
type
ligand
sequence E
description binding site for residue SO4 B 415
source : AE6

58) chain B
residue 159
type
ligand
sequence Q
description binding site for residue SO4 B 415
source : AE6

59) chain B
residue 174
type
ligand
sequence E
description binding site for residue SO4 B 416
source : AE7

60) chain B
residue 230
type
ligand
sequence S
description binding site for residue SO4 B 416
source : AE7

61) chain B
residue 231
type
ligand
sequence E
description binding site for residue SO4 B 416
source : AE7

62) chain B
residue 265
type
ligand
sequence Y
description binding site for residue GOL B 417
source : AE8

63) chain B
residue 311
type
ligand
sequence C
description binding site for residue GOL B 417
source : AE8

64) chain B
residue 312
type
ligand
sequence M
description binding site for residue GOL B 417
source : AE8

65) chain B
residue 313
type
ligand
sequence D
description binding site for residue GOL B 417
source : AE8

66) chain B
residue 138
type
ligand
sequence R
description binding site for residue GOL B 418
source : AE9

67) chain B
residue 166
type
ligand
sequence F
description binding site for residue GOL B 418
source : AE9

68) chain B
residue 168
type
ligand
sequence H
description binding site for residue GOL B 418
source : AE9

69) chain B
residue 203
type
ligand
sequence N
description binding site for residue GOL B 418
source : AE9

70) chain B
residue 219
type
ligand
sequence R
description binding site for residue GOL B 418
source : AE9

71) chain B
residue 265
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

72) chain B
residue 284
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

73) chain B
residue 311-314
type binding
ligand GOL: GLYCEROL
sequence CMDQ
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

74) chain B
residue 39
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_A_409

75) chain B
residue 138
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_A_409

76) chain B
residue 168
type binding
ligand GOL: GLYCEROL
sequence H
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_A_409

77) chain B
residue 39
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

78) chain B
residue 85
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

79) chain B
residue 131
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

80) chain B
residue 138
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

81) chain B
residue 166-168
type binding
ligand GOL: GLYCEROL
sequence FTH
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

82) chain B
residue 203
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

83) chain B
residue 219
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418


Display surface

Download
Links