eF-site ID 6g56-AB
PDB Code 6g56
Chain A, B

click to enlarge
Title Apo-structure of the alanine racemase from Staphylococcus aureus
Classification BIOSYNTHETIC PROTEIN
Compound Alanine racemase 1
Source (ALR1_STAAM)
Sequence A:  SDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVVKAN
AYGLGSVKVARHLMENGATFFAVATLDEAIELRMHGITAK
ILVLGVLPAKDIDKAIQHRVALTVPSKQWLKEAIKNISGE
QEKKLWLHIKLDTGMGRLGIKDTNTYQEVIEIIQQYEQLV
FEGVFTHFACADEPGDMTTEQYQRFKDMVNEAIKPEYIHC
QNSAGSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVHL
KPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIALLP
IGYADGYLRIMQGSFVNVNGHQCEVIGRVCMDQTIVKVPD
QVKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNLS
RRLPRIYHDGDQRFVTNELLK
B:  FSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVVKA
NAYGLGSVKVARHLMENGATFFAVATLDEAIELRMHGITA
KILVLGVLPAKDIDKAIQHRVALTVPSKQWLKEAIKNISG
EQEKKLWLHIKLDTGMGRLGIKDTNTYQEVIEIIQQYEQL
VFEGVFTHFACADEPGDMTTEQYQRFKDMVNEAIKPEYIH
CQNSAGSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVH
LKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIALL
PIGYADGYLRIMQGSFVNVNGHQCEVIGRVCMDQTIVKVP
DQVKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNL
SRRLPRIYHDGDQRFVTNELLK
Description (1)  Alanine racemase 1 (E.C.5.1.1.1)


Functional site

1) chain A
residue 43
type
ligand
sequence Y
description binding site for residue SO4 A 401
source : AC1

2) chain A
residue 203
type
ligand
sequence N
description binding site for residue SO4 A 401
source : AC1

3) chain A
residue 204
type
ligand
sequence S
description binding site for residue SO4 A 401
source : AC1

4) chain A
residue 221
type
ligand
sequence G
description binding site for residue SO4 A 401
source : AC1

5) chain A
residue 222
type
ligand
sequence I
description binding site for residue SO4 A 401
source : AC1

6) chain A
residue 354
type
ligand
sequence Y
description binding site for residue SO4 A 401
source : AC1

7) chain A
residue 29
type
ligand
sequence H
description binding site for residue SO4 A 402
source : AC2

8) chain A
residue 30
type
ligand
sequence P
description binding site for residue SO4 A 402
source : AC2

9) chain A
residue 31
type
ligand
sequence N
description binding site for residue SO4 A 402
source : AC2

10) chain A
residue 32
type
ligand
sequence K
description binding site for residue SO4 A 402
source : AC2

11) chain A
residue 211
type
ligand
sequence D
description binding site for residue SO4 A 402
source : AC2

12) chain A
residue 213
type
ligand
sequence Q
description binding site for residue SO4 A 402
source : AC2

13) chain A
residue 228
type
ligand
sequence Y
description binding site for residue SO4 A 403
source : AC3

14) chain A
residue 234
type
ligand
sequence Q
description binding site for residue SO4 A 403
source : AC3

15) chain A
residue 240
type
ligand
sequence H
description binding site for residue SO4 A 403
source : AC3

16) chain A
residue 241
type
ligand
sequence L
description binding site for residue SO4 A 403
source : AC3

17) chain A
residue 336
type
ligand
sequence R
description binding site for residue SO4 A 403
source : AC3

18) chain A
residue 183
type
ligand
sequence Y
description binding site for residue SO4 A 404
source : AC4

19) chain A
residue 187
type
ligand
sequence K
description binding site for residue SO4 A 404
source : AC4

20) chain A
residue 212
type
ligand
sequence C
description binding site for residue SO4 A 404
source : AC4

21) chain A
residue 213
type
ligand
sequence Q
description binding site for residue SO4 A 404
source : AC4

22) chain A
residue 214
type
ligand
sequence F
description binding site for residue SO4 A 404
source : AC4

23) chain A
residue 23
type
ligand
sequence K
description binding site for residue SO4 A 405
source : AC5

24) chain A
residue 184
type
ligand
sequence Q
description binding site for residue SO4 A 405
source : AC5

25) chain A
residue 187
type
ligand
sequence K
description binding site for residue SO4 A 405
source : AC5

26) chain A
residue 107
type
ligand
sequence S
description binding site for residue SO4 A 406
source : AC6

27) chain A
residue 108
type
ligand
sequence K
description binding site for residue SO4 A 406
source : AC6

28) chain A
residue 109
type
ligand
sequence Q
description binding site for residue SO4 A 406
source : AC6

29) chain A
residue 264
type
ligand
sequence S
description binding site for residue SO4 A 407
source : AC7

30) chain A
residue 266
type
ligand
sequence G
description binding site for residue SO4 A 407
source : AC7

31) chain B
residue 138
type
ligand
sequence R
description binding site for residue SO4 A 407
source : AC7

32) chain B
residue 168
type
ligand
sequence H
description binding site for residue SO4 A 407
source : AC7

33) chain B
residue 169
type
ligand
sequence F
description binding site for residue SO4 A 407
source : AC7

34) chain B
residue 171
type
ligand
sequence C
description binding site for residue SO4 A 407
source : AC7

35) chain A
residue 16
type
ligand
sequence N
description binding site for residue SO4 A 408
source : AC8

36) chain A
residue 19
type
ligand
sequence A
description binding site for residue SO4 A 408
source : AC8

37) chain A
residue 53
type
ligand
sequence H
description binding site for residue SO4 A 408
source : AC8

38) chain A
residue 57
type
ligand
sequence N
description binding site for residue SO4 A 408
source : AC8

39) chain A
residue 311
type
ligand
sequence C
description binding site for residue GOL A 409
source : AC9

40) chain A
residue 312
type
ligand
sequence M
description binding site for residue GOL A 409
source : AC9

41) chain A
residue 313
type
ligand
sequence D
description binding site for residue GOL A 409
source : AC9

42) chain A
residue 314
type
ligand
sequence Q
description binding site for residue GOL A 409
source : AC9

43) chain B
residue 39
type
ligand
sequence K
description binding site for residue GOL A 409
source : AC9

44) chain B
residue 138
type
ligand
sequence R
description binding site for residue GOL A 409
source : AC9

45) chain B
residue 43
type
ligand
sequence Y
description binding site for residue SO4 B 401
source : AD1

46) chain B
residue 203
type
ligand
sequence N
description binding site for residue SO4 B 401
source : AD1

47) chain B
residue 204
type
ligand
sequence S
description binding site for residue SO4 B 401
source : AD1

48) chain B
residue 221
type
ligand
sequence G
description binding site for residue SO4 B 401
source : AD1

49) chain B
residue 222
type
ligand
sequence I
description binding site for residue SO4 B 401
source : AD1

50) chain B
residue 354
type
ligand
sequence Y
description binding site for residue SO4 B 401
source : AD1

51) chain B
residue 228
type
ligand
sequence Y
description binding site for residue SO4 B 402
source : AD2

52) chain B
residue 234
type
ligand
sequence Q
description binding site for residue SO4 B 402
source : AD2

53) chain B
residue 240
type
ligand
sequence H
description binding site for residue SO4 B 402
source : AD2

54) chain B
residue 241
type
ligand
sequence L
description binding site for residue SO4 B 402
source : AD2

55) chain B
residue 336
type
ligand
sequence R
description binding site for residue SO4 B 402
source : AD2

56) chain B
residue 183
type
ligand
sequence Y
description binding site for residue SO4 B 403
source : AD3

57) chain B
residue 187
type
ligand
sequence K
description binding site for residue SO4 B 403
source : AD3

58) chain B
residue 212
type
ligand
sequence C
description binding site for residue SO4 B 403
source : AD3

59) chain B
residue 213
type
ligand
sequence Q
description binding site for residue SO4 B 403
source : AD3

60) chain B
residue 214
type
ligand
sequence F
description binding site for residue SO4 B 403
source : AD3

61) chain B
residue 143
type
ligand
sequence D
description binding site for residue SO4 B 404
source : AD4

62) chain B
residue 144
type
ligand
sequence T
description binding site for residue SO4 B 404
source : AD4

63) chain B
residue 185
type
ligand
sequence R
description binding site for residue SO4 B 404
source : AD4

64) chain B
residue 184
type
ligand
sequence Q
description binding site for residue SO4 B 405
source : AD5

65) chain B
residue 187
type
ligand
sequence K
description binding site for residue SO4 B 405
source : AD5

66) chain A
residue 74
type
ligand
sequence R
description binding site for residue SO4 B 406
source : AD6

67) chain A
residue 99
type
ligand
sequence H
description binding site for residue SO4 B 406
source : AD6

68) chain B
residue 149
type
ligand
sequence E
description binding site for residue SO4 B 406
source : AD6

69) chain B
residue 152
type
ligand
sequence E
description binding site for residue SO4 B 406
source : AD6

70) chain A
residue 100
type
ligand
sequence R
description binding site for residue SO4 B 407
source : AD7

71) chain A
residue 124
type
ligand
sequence K
description binding site for residue SO4 B 407
source : AD7

72) chain B
residue 108
type
ligand
sequence K
description binding site for residue SO4 B 407
source : AD7

73) chain B
residue 112
type
ligand
sequence K
description binding site for residue SO4 B 407
source : AD7

74) chain B
residue 149
type
ligand
sequence E
description binding site for residue SO4 B 407
source : AD7

75) chain B
residue 142
type
ligand
sequence K
description binding site for residue SO4 B 408
source : AD8

76) chain B
residue 143
type
ligand
sequence D
description binding site for residue SO4 B 408
source : AD8

77) chain B
residue 146
type
ligand
sequence T
description binding site for residue SO4 B 408
source : AD8

78) chain A
residue 116
type
ligand
sequence K
description binding site for residue SO4 B 409
source : AD9

79) chain B
residue 210
type
ligand
sequence M
description binding site for residue SO4 B 409
source : AD9

80) chain B
residue 211
type
ligand
sequence D
description binding site for residue SO4 B 409
source : AD9

81) chain B
residue 212
type
ligand
sequence C
description binding site for residue SO4 B 409
source : AD9

82) chain A
residue 108
type
ligand
sequence K
description binding site for residue SO4 B 410
source : AE1

83) chain A
residue 112
type
ligand
sequence K
description binding site for residue SO4 B 410
source : AE1

84) chain B
residue 29
type
ligand
sequence H
description binding site for residue SO4 B 410
source : AE1

85) chain B
residue 30
type
ligand
sequence P
description binding site for residue SO4 B 410
source : AE1

86) chain B
residue 31
type
ligand
sequence N
description binding site for residue SO4 B 410
source : AE1

87) chain B
residue 32
type
ligand
sequence K
description binding site for residue SO4 B 410
source : AE1

88) chain B
residue 213
type
ligand
sequence Q
description binding site for residue SO4 B 410
source : AE1

89) chain B
residue 16
type
ligand
sequence N
description binding site for residue SO4 B 411
source : AE2

90) chain B
residue 19
type
ligand
sequence A
description binding site for residue SO4 B 411
source : AE2

91) chain B
residue 53
type
ligand
sequence H
description binding site for residue SO4 B 411
source : AE2

92) chain B
residue 57
type
ligand
sequence N
description binding site for residue SO4 B 411
source : AE2

93) chain B
residue 49
type
ligand
sequence K
description binding site for residue SO4 B 412
source : AE3

94) chain B
residue 52
type
ligand
sequence R
description binding site for residue SO4 B 412
source : AE3

95) chain B
residue 76
type
ligand
sequence H
description binding site for residue SO4 B 412
source : AE3

96) chain B
residue 74
type
ligand
sequence R
description binding site for residue SO4 B 413
source : AE4

97) chain B
residue 99
type
ligand
sequence H
description binding site for residue SO4 B 413
source : AE4

98) chain B
residue 100
type
ligand
sequence R
description binding site for residue SO4 B 413
source : AE4

99) chain B
residue 124
type
ligand
sequence K
description binding site for residue SO4 B 414
source : AE5

100) chain B
residue 125
type
ligand
sequence K
description binding site for residue SO4 B 414
source : AE5

101) chain A
residue 197
type
ligand
sequence E
description binding site for residue SO4 B 415
source : AE6

102) chain B
residue 157
type
ligand
sequence Y
description binding site for residue SO4 B 415
source : AE6

103) chain B
residue 158
type
ligand
sequence E
description binding site for residue SO4 B 415
source : AE6

104) chain B
residue 159
type
ligand
sequence Q
description binding site for residue SO4 B 415
source : AE6

105) chain B
residue 174
type
ligand
sequence E
description binding site for residue SO4 B 416
source : AE7

106) chain B
residue 230
type
ligand
sequence S
description binding site for residue SO4 B 416
source : AE7

107) chain B
residue 231
type
ligand
sequence E
description binding site for residue SO4 B 416
source : AE7

108) chain A
residue 39
type
ligand
sequence K
description binding site for residue GOL B 417
source : AE8

109) chain B
residue 265
type
ligand
sequence Y
description binding site for residue GOL B 417
source : AE8

110) chain B
residue 311
type
ligand
sequence C
description binding site for residue GOL B 417
source : AE8

111) chain B
residue 312
type
ligand
sequence M
description binding site for residue GOL B 417
source : AE8

112) chain B
residue 313
type
ligand
sequence D
description binding site for residue GOL B 417
source : AE8

113) chain B
residue 138
type
ligand
sequence R
description binding site for residue GOL B 418
source : AE9

114) chain B
residue 166
type
ligand
sequence F
description binding site for residue GOL B 418
source : AE9

115) chain B
residue 168
type
ligand
sequence H
description binding site for residue GOL B 418
source : AE9

116) chain B
residue 203
type
ligand
sequence N
description binding site for residue GOL B 418
source : AE9

117) chain B
residue 219
type
ligand
sequence R
description binding site for residue GOL B 418
source : AE9

118) chain A
residue 39
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

119) chain A
residue 43
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

120) chain A
residue 168
type binding
ligand GOL: GLYCEROL
sequence H
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

121) chain B
residue 265
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

122) chain B
residue 284
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

123) chain B
residue 311-314
type binding
ligand GOL: GLYCEROL
sequence CMDQ
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_417

124) chain A
residue 284
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_A_409

125) chain A
residue 311-314
type binding
ligand GOL: GLYCEROL
sequence CMDQ
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_A_409

126) chain B
residue 39
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_A_409

127) chain B
residue 138
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_A_409

128) chain B
residue 168
type binding
ligand GOL: GLYCEROL
sequence H
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_A_409

129) chain A
residue 314
type binding
ligand GOL: GLYCEROL
sequence Q
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

130) chain B
residue 39
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

131) chain B
residue 85
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

132) chain B
residue 131
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

133) chain B
residue 138
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

134) chain B
residue 166-168
type binding
ligand GOL: GLYCEROL
sequence FTH
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

135) chain B
residue 203
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418

136) chain B
residue 219
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_6g56_B_418


Display surface

Download
Links