eF-site ID 6fyy-T PDB Code 6fyy Chain T click to enlarge Title Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain (model C2) Classification RIBOSOME Compound tRNAi Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; ORGANISM_COMMON: Yeast; Sequence T:  PGVSVRDVPAQDFINNYASFLQRQGKLEVPGYVDIVKTSA GNELPPQDSEGWFYKRAASVARHIYLRKQVGVGKLNKLYG GAKNRGVRPHKHVDASGSINRKVLQSLEKLGVVEISPKGG RRISDNGLRDLDRIAAATLEDEE Description (1)  30S ribosomal protein S2, 30S ribosomal protein S3, 30S ribosomal protein S4, 30S ribosomal protein S5, 30S ribosomal protein S6, 30S ribosomal protein S7, 30S ribosomal protein S8, 30S ribosomal protein S9, 30S ribosomal protein S10, 30S ribosomal protein S11, 30S ribosomal protein S12, 30S ribosomal protein S13, 30S ribosomal protein S14 type Z, 30S ribosomal protein S15, 30S ribosomal protein S16, 30S ribosomal protein S17, 30S ribosomal protein S18, 30S ribosomal protein S19, 30S ribosomal protein S20, 30S ribosomal protein Thx, Translation initiation factor IF-1, Translation initiation factor IF-3/RNA Complex Functional site 1) chain T residue 44 type sequence E description binding site for residue MG 2 1859 source : AH8 2) chain T residue 85 type sequence N description binding site for residue MG 2 1869 source : AI6 3) chain T residue 79 type sequence L description binding site for residue MG 2 1890 source : AK6 4) chain T residue 90-109 type prosite sequence PHKHVDASGSINRKVLQSLE description RIBOSOMAL_S19E Ribosomal protein S19e signature. PhkhvdaSgsInRkVLQsLE source prosite : PS00628

Display surface Download Links