eF-site ID 6fyx-c
PDB Code 6fyx
Chain c

click to enlarge
Title Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain (model C1)
Classification RIBOSOME
Compound tRNAi
Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; ORGANISM_COMMON: Yeast;
Sequence c:  KTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRN
VKGPVREGDILVLMESEREARRLR
Description (1)  30S ribosomal protein S2, 30S ribosomal protein S3, 30S ribosomal protein S4, 30S ribosomal protein S5, 30S ribosomal protein S6, 30S ribosomal protein S7, 30S ribosomal protein S8, 30S ribosomal protein S9, 30S ribosomal protein S10, 30S ribosomal protein S11, 30S ribosomal protein S12, 30S ribosomal protein S13, 30S ribosomal protein S14 type Z, 30S ribosomal protein S15, 30S ribosomal protein S16, 30S ribosomal protein S17, 30S ribosomal protein S18, 30S ribosomal protein S19, 30S ribosomal protein S20, 30S ribosomal protein Thx, Translation initiation factor IF-1, Translation initiation factor IF-3/RNA Complex


Functional site

1) chain c
residue 58-66
type prosite
sequence ESEREARRL
description RIBOSOMAL_S28E Ribosomal protein S28e signature. ESEREARrL
source prosite : PS00961


Display surface

Download
Links