eF-site ID 6fv2-B PDB Code 6fv2 Chain B click to enlarge Title Structure of human coronavirus NL63 main protease in complex with the alpha-ketoamide (S)-N-benzyl-3-((S)-2-cinnamamido-3-phenylpropanamido)-2-oxo-4-((S)-2-oxopyrrolidin-3-yl)butanamide (cinnamoyl-phenylalanine-GlnLactam-CO-CO-NH-benzyl) Classification HYDROLASE Compound 3C-like proteinase Source (R1AB_CVHNL) Sequence B:  SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPR HVIAPSTTVLIDYDHAYSTMRLHNFSVSHNGVFLGVVGVT MHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEGI ASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFC YLHQIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLML SDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYT SVSSVECYSILAAKTGVSVEQLLASIQHLHEGFGGKNILG YSSLCDEFTLAEVVKQMYG Description (1)  Replicase polyprotein 1ab (E.C.3.4.19.12,3.4.22.69,3.4.22.-,2.7.7.48,3.6.4.12,3.6.4.13,2.1.1.-,3.1.13.-,3.1.-.-) Functional site 1) chain B residue 40 type sequence R description binding site for residue GOL B 401 source : AC3 2) chain B residue 27 type sequence L description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 3) chain B residue 28 type sequence N description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 4) chain B residue 41 type sequence H description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 5) chain B residue 47 type sequence T description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 6) chain B residue 139 type sequence F description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 7) chain B residue 141 type sequence N description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 8) chain B residue 142 type sequence G description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 9) chain B residue 143 type sequence A description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 10) chain B residue 145 type sequence G description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 11) chain B residue 146 type sequence S description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 12) chain B residue 163 type sequence H description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 13) chain B residue 164 type sequence Q description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 14) chain B residue 165 type sequence I description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 15) chain B residue 166 type sequence E description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 16) chain B residue 187 type sequence D description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 17) chain B residue 188 type sequence Q description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 18) chain B residue 190 type sequence S description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 19) chain B residue 192 type sequence Q description binding site for Di-peptide D03 B 402 and CYS B 144 source : AC5 20) chain B residue 41 type ACT_SITE sequence H description For 3CL-PRO activity => ECO:0000255|PROSITE-ProRule:PRU00772 source Swiss-Prot : SWS_FT_FI1 21) chain B residue 144 type ACT_SITE sequence C description For 3CL-PRO activity => ECO:0000255|PROSITE-ProRule:PRU00772 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links