eF-site ID 6fqu-A PDB Code 6fqu Chain A click to enlarge Title Crystal structure of CREBBP bromodomain complexd with DR09 Classification TRANSFERASE Compound CREB-binding protein Source (CBP_HUMAN) Sequence A:  KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLG IPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMF NNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG Description Functional site 1) chain A residue 1110 type sequence P description binding site for residue E3B A 1201 source : AC1 2) chain A residue 1115 type sequence V description binding site for residue E3B A 1201 source : AC1 3) chain A residue 1168 type sequence N description binding site for residue E3B A 1201 source : AC1 4) chain A residue 1173 type sequence R description binding site for residue E3B A 1201 source : AC1 5) chain A residue 1177 type sequence F description binding site for residue E3B A 1201 source : AC1 6) chain A residue 1108-1167 type prosite sequence SLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQY QEPWQYVDDVWLMFNNAWLY description BROMODOMAIN_1 Bromodomain signature. SlpFrqpvDpqllgipDYFdiVknpMdlstIkrkldtgq..Yqepwqyvddvwl.MfnNAwlY source prosite : PS00633

Display surface Download Links