eF-site ID 6fpg-G PDB Code 6fpg Chain G click to enlarge Title Structure of the Ustilago maydis chorismate mutase 1 in complex with a Zea mays kiwellin Classification CELL INVASION Compound Chromosome 16, whole genome shotgun sequence Source (A0A1D6GNR3_MAIZE) Sequence G:  GKSEAAEIEAGDRLDALRDQLQRYETPIIQTILARSALGG RAPSEQDEVRAALSRNAFEPSEVISEWLQTESGARFRSTR PLPPAVEFITPVVLSRDTVLDKPVVGKGIFPIGRRPQDPT NMDEFLDTSLLSLNQSSTVDLASAVSLDVSLLHLVSARVL LGYPIALAKFDWLHDNFCHILTNTTLSKSQKLANIIQQLT DHKQEVNVLSRVEQKSKSLSHLFRNDIPYPPHTQDRILRL FQAYLIPITTQIEAAAILDHANKCT Description Functional site 1) chain G residue 43 type sequence R description binding site for residue CIT G 301 source : AC4 2) chain G residue 190 type sequence I description binding site for residue CIT G 301 source : AC4 3) chain G residue 194 type sequence K description binding site for residue CIT G 301 source : AC4 4) chain G residue 229 type sequence Q description binding site for residue CIT G 301 source : AC4 5) chain G residue 278 type sequence E description binding site for residue CIT G 301 source : AC4 6) chain G residue 159 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 7) chain G residue 208 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links