eF-site ID 6fpg-F PDB Code 6fpg Chain F click to enlarge Title Structure of the Ustilago maydis chorismate mutase 1 in complex with a Zea mays kiwellin Classification CELL INVASION Compound Chromosome 16, whole genome shotgun sequence Source (A0A1D6GNR3_MAIZE) Sequence F:  GKSEAAEIEAGDRLDALRDQLQRYETPIIQTILARSALGG RAPSEQDEVRAALSRNAFEPSEVISEWLQTESGARFRSTR PLPPAVEFITPVVLSRDTVLDKPVVGKGIFPIGRRPQDPT NMDEFLDTSLLSLNQSSTVDLASAVSLDVSLLHLVSARVL LGYPIALAKFDWLHDNFCHILTNTTLSKSQKLANIIQQLT DHKQEVNVLSRVEQKSKSLSHLFRNDIPYPPHTQDRILRL FQAYLIPITTQIEAAAILDHANKCTL Description Functional site 1) chain F residue 43 type sequence R description binding site for residue CIT F 301 source : AC3 2) chain F residue 190 type sequence I description binding site for residue CIT F 301 source : AC3 3) chain F residue 194 type sequence K description binding site for residue CIT F 301 source : AC3 4) chain F residue 229 type sequence Q description binding site for residue CIT F 301 source : AC3 5) chain F residue 278 type sequence E description binding site for residue CIT F 301 source : AC3 6) chain F residue 159 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 7) chain F residue 208 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links