eF-site ID 6fpg-C PDB Code 6fpg Chain C click to enlarge Title Structure of the Ustilago maydis chorismate mutase 1 in complex with a Zea mays kiwellin Classification CELL INVASION Compound Chromosome 16, whole genome shotgun sequence Source (A0A1D6GNR3_MAIZE) Sequence C:  SEAAEIEAGDRLDALRDQLQRYETPIIQTILARSALGGRA PSEQDEVRAALSRNAFEPSEVISEWLQTESGARFRSTRPL PPAVEFITPVVLSRDTVLDKPVVGKGIFPIGRRPQDPTNM DEFLDTSLLSLNQSSTVDLASAVSLDVSLLHLVSARVLLG YPIALAKFDWLHDNFCHILTNTTLSKSQKLANIIQQLTDH KQEVNVLSRVEQKSKSLSHLFRNDIPYPPHTQDRILRLFQ AYLIPITTQIEAAAILDHANKC Description Functional site 1) chain C residue 43 type sequence R description binding site for residue CIT C 301 source : AC1 2) chain C residue 190 type sequence I description binding site for residue CIT C 301 source : AC1 3) chain C residue 194 type sequence K description binding site for residue CIT C 301 source : AC1 4) chain C residue 229 type sequence Q description binding site for residue CIT C 301 source : AC1 5) chain C residue 278 type sequence E description binding site for residue CIT C 301 source : AC1 6) chain C residue 159 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 7) chain C residue 208 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links