eF-site ID 6fms-D PDB Code 6fms Chain D click to enlarge Title IMISX-EP of Se-LspA Classification HYDROLASE Compound Lipoprotein signal peptidase Source (6FMS) Sequence D:  PWLWITVLVFVLDQVSKAFFQAELSXYQQIVVIPDLFSWT LAYNTGAAFSFLADSSGWQRWLFALIAIVVSASLVVWLKR LKKGETWLAIALALVLGGALGNLYDRXVLGHVVDFILVHW QNRWYFPAFNLADSAITVGAVXLALDXFR Description Functional site 1) chain D residue 28 type sequence A description binding site for residue OLC A 203 source : AC3 2) chain D residue 32 type sequence A description binding site for residue OLC A 203 source : AC3 3) chain D residue 31 type sequence Q description binding site for residue OLC A 204 source : AC4 4) chain D residue 114 type sequence Y description binding site for residue OLC A 204 source : AC4 5) chain D residue 29 type sequence F description binding site for residue OLC D 201 source : AD7 6) chain D residue 40 type sequence I description binding site for residue OLC D 201 source : AD7 7) chain D residue 49 type sequence W description binding site for residue OLC D 202 source : AD8 8) chain D residue 139 type sequence F description binding site for residue OLC H 301 source : AE2 9) chain D residue 143 type sequence D description binding site for residue OLC H 301 source : AE2 10) chain D residue 147 type sequence T description binding site for residue OLC H 301 source : AE2 11) chain D residue 54 type sequence N description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 12) chain D residue 57 type sequence A description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 13) chain D residue 59 type sequence F description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 14) chain D residue 73 type sequence F description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 15) chain D residue 80 type sequence V description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 16) chain D residue 109 type sequence A description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 17) chain D residue 112 type sequence N description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 18) chain D residue 116 type sequence R description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 19) chain D residue 124 type sequence D description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 20) chain D residue 143 type sequence D description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 21) chain D residue 146 type sequence I description binding site for Ligand residues ALO H 204 through SER H 203 bound to SER H 203 source : AE6 22) chain D residue 31-67 type TOPO_DOM sequence QAELSXYQQIVVIPDLFSWTLAYNTGAAFSFLADSSG description Periplasmic => ECO:0000269|PubMed:26912896, ECO:0000269|PubMed:30272004, ECO:0007744|PDB:5DIR, ECO:0007744|PDB:6FMS source Swiss-Prot : SWS_FT_FI2 23) chain D residue 119-140 type TOPO_DOM sequence LGHVVDFILVHWQNRWYFPAFN description Periplasmic => ECO:0000269|PubMed:26912896, ECO:0000269|PubMed:30272004, ECO:0007744|PDB:5DIR, ECO:0007744|PDB:6FMS source Swiss-Prot : SWS_FT_FI2 24) chain D residue 68-89 type TRANSMEM sequence WQRWLFALIAIVVSASLVVWLK description Helical => ECO:0000269|PubMed:26912896, ECO:0000269|PubMed:30272004, ECO:0007744|PDB:5DIR, ECO:0007744|PDB:6FMS source Swiss-Prot : SWS_FT_FI3 25) chain D residue 97-118 type TRANSMEM sequence WLAIALALVLGGALGNLYDRXV description Helical => ECO:0000269|PubMed:26912896, ECO:0000269|PubMed:30272004, ECO:0007744|PDB:5DIR, ECO:0007744|PDB:6FMS source Swiss-Prot : SWS_FT_FI3 26) chain D residue 90-96 type TOPO_DOM sequence RLKKGET description Cytoplasmic => ECO:0000269|PubMed:26912896, ECO:0000269|PubMed:30272004, ECO:0007744|PDB:5DIR, ECO:0007744|PDB:6FMS source Swiss-Prot : SWS_FT_FI4 27) chain D residue 141-154 type TRANSMEM sequence LADSAITVGAVXLA description Helical => ECO:0000269|PubMed:26912896, ECO:0007744|PDB:5DIR source Swiss-Prot : SWS_FT_FI5 28) chain D residue 124 type ACT_SITE sequence D description ACT_SITE => ECO:0000255|HAMAP-Rule:MF_00161, ECO:0000305|PubMed:26912896 source Swiss-Prot : SWS_FT_FI7 29) chain D residue 143 type ACT_SITE sequence D description ACT_SITE => ECO:0000255|HAMAP-Rule:MF_00161, ECO:0000305|PubMed:26912896 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links