eF-site ID 6fm0-A PDB Code 6fm0 Chain A click to enlarge Title Deoxyguanylosuccinate synthase (DgsS) and ATP structure at 1.7 Angstrom resolution Classification BIOSYNTHETIC PROTEIN Compound Adenylosuccinate synthetase Source (G3FFN6_9CAUD) Sequence A:  ENVDLVIDLQFGSTGKGLIAGYLAEKNGYDTVINANMPNA GHTYINAEGRKWMHKVLPNGIVSPNLKRVMLGAGSVFSIN RLMEEIEMSKDLLHDKVAILIHPMATVLDSMAAMVEKLQR DPTNNTIVARDVAQYDGRIAQYVCTVEEWDMALMASERIL AEGAQGFSLSLNQEFYPYCTSRDCTPARFLADMGIPLPML NKVIGTARCHPIRGHYPDQEERVFSFSFIQMQKAMWTCQP DEVFLNFCNYLSPMGWQDIVHQIEVAAQSRYCDAEVKYLG FGPTFNDVELREDV Description (1)  Adenylosuccinate synthetase Functional site 1) chain A residue 14 type sequence S description binding site for residue ATP A 401 source : AC1 2) chain A residue 15 type sequence T description binding site for residue ATP A 401 source : AC1 3) chain A residue 16 type sequence G description binding site for residue ATP A 401 source : AC1 4) chain A residue 17 type sequence K description binding site for residue ATP A 401 source : AC1 5) chain A residue 18 type sequence G description binding site for residue ATP A 401 source : AC1 6) chain A residue 43 type sequence H description binding site for residue ATP A 401 source : AC1 7) chain A residue 294 type sequence N description binding site for residue ATP A 401 source : AC1 8) chain A residue 295 type sequence F description binding site for residue ATP A 401 source : AC1 9) chain A residue 297 type sequence N description binding site for residue ATP A 401 source : AC1 10) chain A residue 330 type sequence G description binding site for residue ATP A 401 source : AC1 11) chain A residue 331 type sequence P description binding site for residue ATP A 401 source : AC1 12) chain A residue 14 type ACT_SITE sequence S description Proton acceptor => ECO:0000255|HAMAP-Rule:MF_04166, ECO:0000305|PubMed:33926954 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 14 type BINDING sequence S description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 142 type BINDING sequence R description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 187 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 202 type BINDING sequence T description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 294 type BINDING sequence N description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 297 type BINDING sequence N description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 330 type BINDING sequence G description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 15 type BINDING sequence T description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 16 type BINDING sequence G description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 17 type BINDING sequence K description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 18 type BINDING sequence G description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 40 type BINDING sequence N description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 42 type BINDING sequence G description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 43 type BINDING sequence H description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 44 type BINDING sequence T description BINDING => ECO:0000269|PubMed:33926955, ECO:0007744|PDB:6FM1 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links