eF-site ID 6fki-p PDB Code 6fki Chain p click to enlarge Title Chloroplast F1Fo conformation 3 Classification MEMBRANE PROTEIN Compound ATP synthase subunit a, chloroplastic Source ORGANISM_COMMON: Spinach; ORGANISM_SCIENTIFIC: Spinacia oleracea; Sequence p:  IEKASLFDFNLTLPIIMAEFLFLMFALDKIYYTPLGDFMD KRDASIKEQLSGVKDTSSEVKQLEEQANAVMRAARAEISA ALNKMKKETQLEVEAKLAEGRKKIEVELQEALGSLEQQKE DTIKSLDSQISALSDDIVKKVLP Description (1)  ATP synthase subunit a, chloroplastic, ATP synthase subunit b, chloroplastic, ATP synthase delta chain, chloroplastic, ATP synthase subunit b', chloroplastic, ATP synthase epsilon chain, chloroplastic, ATP synthase gamma chain, chloroplastic, ATP synthase subunit c, chloroplastic, ATP synthase subunit alpha, chloroplastic (E.C.3.6.3.14), ATP synthase subunit beta, chloroplastic (E.C.3.6.3.14) Functional site 1) chain p residue 203 type sequence L description binding site for Ligand GLN p 206 bound to SER A 10 source : AD2 2) chain p residue 204 type sequence D description binding site for Ligand GLN p 206 bound to SER A 10 source : AD2 3) chain p residue 205 type sequence S description binding site for Ligand GLN p 206 bound to SER A 10 source : AD2 4) chain p residue 207 type sequence I description binding site for Ligand GLN p 206 bound to SER A 10 source : AD2 5) chain p residue 208 type sequence S description binding site for Ligand GLN p 206 bound to SER A 10 source : AD2 6) chain p residue 209 type sequence A description binding site for Ligand GLN p 206 bound to SER A 10 source : AD2 7) chain p residue 210 type sequence L description binding site for Ligand GLN p 206 bound to SER A 10 source : AD2 8) chain p residue 203 type sequence L description binding site for Ligand GLN p 206 bound to SER A 10 source : AD3 9) chain p residue 204 type sequence D description binding site for Ligand GLN p 206 bound to SER A 10 source : AD3 10) chain p residue 205 type sequence S description binding site for Ligand GLN p 206 bound to SER A 10 source : AD3 11) chain p residue 207 type sequence I description binding site for Ligand GLN p 206 bound to SER A 10 source : AD3 12) chain p residue 208 type sequence S description binding site for Ligand GLN p 206 bound to SER A 10 source : AD3 13) chain p residue 209 type sequence A description binding site for Ligand GLN p 206 bound to SER A 10 source : AD3 14) chain p residue 210 type sequence L description binding site for Ligand GLN p 206 bound to SER A 10 source : AD3 15) chain p residue 203 type sequence L description binding site for Ligand GLN p 206 bound to SER A 10 source : AD4 16) chain p residue 204 type sequence D description binding site for Ligand GLN p 206 bound to SER A 10 source : AD4 17) chain p residue 205 type sequence S description binding site for Ligand GLN p 206 bound to SER A 10 source : AD4 18) chain p residue 207 type sequence I description binding site for Ligand GLN p 206 bound to SER A 10 source : AD4 19) chain p residue 208 type sequence S description binding site for Ligand GLN p 206 bound to SER A 10 source : AD4 20) chain p residue 209 type sequence A description binding site for Ligand GLN p 206 bound to SER A 10 source : AD4 21) chain p residue 210 type sequence L description binding site for Ligand GLN p 206 bound to SER A 10 source : AD4 22) chain p residue 203 type sequence L description binding site for Ligand GLN p 206 bound to SER A 10 source : AD5 23) chain p residue 204 type sequence D description binding site for Ligand GLN p 206 bound to SER A 10 source : AD5 24) chain p residue 205 type sequence S description binding site for Ligand GLN p 206 bound to SER A 10 source : AD5 25) chain p residue 207 type sequence I description binding site for Ligand GLN p 206 bound to SER A 10 source : AD5 26) chain p residue 208 type sequence S description binding site for Ligand GLN p 206 bound to SER A 10 source : AD5 27) chain p residue 209 type sequence A description binding site for Ligand GLN p 206 bound to SER A 10 source : AD5 28) chain p residue 210 type sequence L description binding site for Ligand GLN p 206 bound to SER A 10 source : AD5

Display surface Download Links