eF-site ID 6fki-d PDB Code 6fki Chain d click to enlarge Title Chloroplast F1Fo conformation 3 Classification MEMBRANE PROTEIN Compound ATP synthase subunit a, chloroplastic Source ORGANISM_COMMON: Spinach; ORGANISM_SCIENTIFIC: Spinacia oleracea; Sequence d:  VDSTASRYASALADVADVTGTLEATNSDVEKLIRIFSEEP VYYFFANPVISIDNKRSVLDEIITTSGLQPHTANFINILI DSERINLVKEILNEFEDVFNKITGTEVAVVTSVVKLENDH LAQIAKGVQKITGAKNVRIKTVIDPSLVAGFTIRYGNEGS KLVDMSVKKQLEEIAAQLE Description (1)  ATP synthase subunit a, chloroplastic, ATP synthase subunit b, chloroplastic, ATP synthase delta chain, chloroplastic, ATP synthase subunit b', chloroplastic, ATP synthase epsilon chain, chloroplastic, ATP synthase gamma chain, chloroplastic, ATP synthase subunit c, chloroplastic, ATP synthase subunit alpha, chloroplastic (E.C.3.6.3.14), ATP synthase subunit beta, chloroplastic (E.C.3.6.3.14) Functional site 1) chain d residue 72 type sequence D description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD6 2) chain d residue 76 type sequence S description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD6 3) chain d residue 164 type sequence E description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD6 4) chain d residue 72 type sequence D description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD7 5) chain d residue 76 type sequence S description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD7 6) chain d residue 164 type sequence E description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD7 7) chain d residue 72 type sequence D description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD8 8) chain d residue 76 type sequence S description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD8 9) chain d residue 164 type sequence E description binding site for Ligand VAL d 71 bound to ASN A 70 source : AD8 10) chain d residue 207-226 type prosite sequence VRIKTVIDPSLVAGFTIRYG description ATPASE_DELTA ATP synthase delta (OSCP) subunit signature. VrIktvIDpSLvAGFTIRyG source prosite : PS00389

Display surface Download Links