eF-site ID 6fco-ABCDEF PDB Code 6fco Chain A, B, C, D, E, F click to enlarge Title Structural and functional characterisation of Frataxin (FXN) like protein from Chaetomium thermophilum Classification TRANSPORT PROTEIN Compound Mitochondrial frataxin-like protein Source (G0S1Z8_CHATD) Sequence A:  SMADITTAEYHRLADEYLDALLSRLEELQDEREDVDVEYQ SGVLTLNMGPEVGTYVINKQPPNKQIWLSSPKSGPKRYDY VITGEGQNEKQDTAVGEWVYLRDGSTLNQLLLEEIGVDL B:  MADITTAEYHRLADEYLDALLSRLEELQDEREDVDVEYQS GVLTLNMGPEVGTYVINKQPPNKQIWLSSPKSGPKRYDYV ITGEGQNEKQDTAVGEWVYLRDGSTLNQLLLEEIGVDL C:  SMADITTAEYHRLADEYLDALLSRLEELQDEREDVDVEYQ SGVLTLNMGPEVGTYVINKQPPNKQIWLSSPKSGPKRYDY VITGEGQNEKQDTAVGEWVYLRDGSTLNQLLLEEIGVDLN V D:  MADITTAEYHRLADEYLDALLSRLEELQDEREDVDVEYQS GVLTLNMGPEVGTYVINKQPPNKQIWLSSPKSGPKRYDYV ITGEGQNEGEWVYLRDGSTLNQLLLEEIGVDL E:  MADITTAEYHRLADEYLDALLSRLEELQDEREDVDVEYQS GVLTLNMGPEVGTYVINKQPPNKQIWLSSPKSGPKRYDYV IGEWVYLRDGSTLNQLLLEEIGVDLNV F:  MADITTAEYHRLADEYLDALLSRLEELQDEREDVDVEYQS GVLTLNMGPEVGTYVINKQPPNKQIWLSSPKSGPKRYDYV IGEWVYLRDGSTLNQLLLEEIGVDLNV Description (1)  Mitochondrial frataxin-like protein Functional site 1) chain A residue 160 type sequence K description binding site for residue MLA A 301 source : AC1 2) chain A residue 161 type sequence R description binding site for residue MLA A 301 source : AC1 3) chain A residue 184 type sequence Y description binding site for residue MLA A 301 source : AC1 4) chain E residue 186 type sequence R description binding site for residue MLA A 301 source : AC1 5) chain A residue 186 type sequence R description binding site for residue MLA A 302 source : AC2 6) chain C residue 186 type sequence R description binding site for residue MLA A 302 source : AC2 7) chain E residue 159 type sequence P description binding site for residue MLA A 302 source : AC2 8) chain F residue 159 type sequence P description binding site for residue MLA A 302 source : AC2 9) chain F residue 161 type sequence R description binding site for residue MLA A 302 source : AC2 10) chain F residue 184 type sequence Y description binding site for residue MLA A 302 source : AC2 11) chain C residue 161 type sequence R description binding site for residue MLA C 301 source : AC3 12) chain C residue 184 type sequence Y description binding site for residue MLA C 301 source : AC3 13) chain F residue 186 type sequence R description binding site for residue MLA C 301 source : AC3 14) chain A residue 186 type sequence R description binding site for residue MLA C 302 source : AC4 15) chain C residue 186 type sequence R description binding site for residue MLA C 302 source : AC4 16) chain E residue 159 type sequence P description binding site for residue MLA C 302 source : AC4 17) chain E residue 161 type sequence R description binding site for residue MLA C 302 source : AC4 18) chain E residue 184 type sequence Y description binding site for residue MLA C 302 source : AC4 19) chain A residue 140-154 type prosite sequence VINKQPPNKQIWLSS description FRATAXIN_1 Frataxin family signature. VINKQpPnkQIWlSS source prosite : PS01344

Display surface Download Links