eF-site ID 6f1t-J PDB Code 6f1t Chain J click to enlarge Title Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Classification MOTOR PROTEIN Compound ARP1 actin related protein 1 homolog A Source ORGANISM_COMMON: Pig; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence J:  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKP IKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVV IESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTL GINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKAL HKELETQLLEQCTVDTGQSLPSVMGSIPEGVLEDIKVRTC FVSDLTRGLKIQAAKFNRPSPPPNVDYPLDGEKILHVLGS IRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAE NLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTF RIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQT GRIPDWCSL Description Functional site 1) chain J residue 21 type sequence G description binding site for residue ADP J 800 source : AD1 2) chain J residue 22 type sequence E description binding site for residue ADP J 800 source : AD1 3) chain J residue 23 type sequence A description binding site for residue ADP J 800 source : AD1 4) chain J residue 24 type sequence F description binding site for residue ADP J 800 source : AD1 5) chain J residue 26 type sequence K description binding site for residue ADP J 800 source : AD1 6) chain J residue 142 type sequence G description binding site for residue ADP J 800 source : AD1 7) chain J residue 143 type sequence Y description binding site for residue ADP J 800 source : AD1 8) chain J residue 211 type sequence K description binding site for residue ADP J 800 source : AD1 9) chain J residue 308 type sequence G description binding site for residue ADP J 800 source : AD1 10) chain J residue 309 type sequence T description binding site for residue ADP J 800 source : AD1 11) chain J residue 311 type sequence M description binding site for residue ADP J 800 source : AD1 12) chain J residue 351 type sequence N description binding site for residue ADP J 800 source : AD1

Display surface Download Links