eF-site ID 6f08-ABDIJKNQ PDB Code 6f08 Chain A, B, D, I, J, K, N, Q click to enlarge Title 14-3-3 zeta in complex with the human Son of sevenless homolog 1 (SOS1) Classification PEPTIDE BINDING PROTEIN Compound 14-3-3 protein zeta/delta Source Homo sapiens (Human) (SOS1_HUMAN) Sequence A:  MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEE RNLLSVAYKNVVGARRSSWRVVSSIEQKKKQQMAREYREK IETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDY YRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHP IRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDT LSEESYKDSTLIMQLLRDNLTLWTS B:  MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEE RNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK MKGDYYRYLAEVAADDKKGIVDQSQQAYQEAFEISKKEMQ PTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIA ELDTSYKDSTLIMQLLRDNLTLWTS D:  RRPEXAPAE I:  DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEER NLLSVAYKNVVGARRSSWRVVSSIEQKEKKQQMAREYREK IETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDY YRYLAEVAAGDKKGIVDQSQQAYQEAFEISKKEMQPTHPI RLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTL SEESYKDSTLIMQLLRDNLTLWTS J:  MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEE RNLLSVAYKNVVGARRSSWRVVSSIEQKTEKKQQMAREYR EKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKG DYYRYLAEVAKGIVDQSQQAYQEAFEISKKEMQPTHPIRL GLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDSYKD STLIMQLLRDNLTLWTS K:  RRRPEXAPAE N:  RRPEXAPA Q:  RRPEXAPAES Description Functional site 1) chain A residue 1 type sequence M description binding site for residue 1PE A 301 source : AC1 2) chain A residue 9 type sequence K description binding site for residue 1PE A 301 source : AC1 3) chain A residue 21 type sequence D description binding site for residue 1PE A 301 source : AC1 4) chain A residue 25 type sequence C description binding site for residue 1PE A 301 source : AC1 5) chain B residue 78 type sequence M description binding site for residue 1PE A 301 source : AC1 6) chain B residue 82 type sequence Y description binding site for residue 1PE A 301 source : AC1 7) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000269|Ref.8, ECO:0007744|PubMed:22223895, ECO:0007744|PubMed:22814378, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI2 8) chain B residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000269|Ref.8, ECO:0007744|PubMed:22223895, ECO:0007744|PubMed:22814378, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI2 9) chain J residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000269|Ref.8, ECO:0007744|PubMed:22223895, ECO:0007744|PubMed:22814378, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 12) chain B residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 13) chain B residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 14) chain I residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 15) chain I residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 16) chain J residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 17) chain J residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 18) chain A residue 58 type MOD_RES sequence S description Phosphoserine; by PKA and PKB/AKT1 => ECO:0000269|PubMed:11956222, ECO:0000269|PubMed:12865427, ECO:0000269|PubMed:15883165, ECO:0000269|PubMed:16376338 source Swiss-Prot : SWS_FT_FI4 19) chain B residue 58 type MOD_RES sequence S description Phosphoserine; by PKA and PKB/AKT1 => ECO:0000269|PubMed:11956222, ECO:0000269|PubMed:12865427, ECO:0000269|PubMed:15883165, ECO:0000269|PubMed:16376338 source Swiss-Prot : SWS_FT_FI4 20) chain I residue 58 type MOD_RES sequence S description Phosphoserine; by PKA and PKB/AKT1 => ECO:0000269|PubMed:11956222, ECO:0000269|PubMed:12865427, ECO:0000269|PubMed:15883165, ECO:0000269|PubMed:16376338 source Swiss-Prot : SWS_FT_FI4 21) chain J residue 58 type MOD_RES sequence S description Phosphoserine; by PKA and PKB/AKT1 => ECO:0000269|PubMed:11956222, ECO:0000269|PubMed:12865427, ECO:0000269|PubMed:15883165, ECO:0000269|PubMed:16376338 source Swiss-Prot : SWS_FT_FI4 22) chain A residue 184 type MOD_RES sequence S description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:15071501, ECO:0000269|PubMed:15696159 source Swiss-Prot : SWS_FT_FI5 23) chain B residue 184 type MOD_RES sequence S description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:15071501, ECO:0000269|PubMed:15696159 source Swiss-Prot : SWS_FT_FI5 24) chain I residue 184 type MOD_RES sequence S description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:15071501, ECO:0000269|PubMed:15696159 source Swiss-Prot : SWS_FT_FI5 25) chain J residue 184 type MOD_RES sequence S description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:15071501, ECO:0000269|PubMed:15696159 source Swiss-Prot : SWS_FT_FI5 26) chain A residue 207 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI6 27) chain I residue 207 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI6 28) chain A residue 210 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63102 source Swiss-Prot : SWS_FT_FI7 29) chain B residue 210 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63102 source Swiss-Prot : SWS_FT_FI7 30) chain I residue 210 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63102 source Swiss-Prot : SWS_FT_FI7 31) chain J residue 210 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63102 source Swiss-Prot : SWS_FT_FI7 32) chain D residue 7 type MOD_RES sequence X description Phosphoserine; by RPS6KA3 => ECO:0000269|PubMed:22827337 source Swiss-Prot : SWS_FT_FI1 33) chain K residue 7 type MOD_RES sequence X description Phosphoserine; by RPS6KA3 => ECO:0000269|PubMed:22827337 source Swiss-Prot : SWS_FT_FI1 34) chain N residue 7 type MOD_RES sequence X description Phosphoserine; by RPS6KA3 => ECO:0000269|PubMed:22827337 source Swiss-Prot : SWS_FT_FI1 35) chain Q residue 7 type MOD_RES sequence X description Phosphoserine; by RPS6KA3 => ECO:0000269|PubMed:22827337 source Swiss-Prot : SWS_FT_FI1 36) chain I residue 56 type MOD_RES sequence R description Phosphoserine; by RPS6KA3 => ECO:0000269|PubMed:22827337 source Swiss-Prot : SWS_FT_FI1 37) chain I residue 127 type MOD_RES sequence R description Phosphoserine; by RPS6KA3 => ECO:0000269|PubMed:22827337 source Swiss-Prot : SWS_FT_FI1 38) chain J residue 56 type MOD_RES sequence R description Phosphoserine; by RPS6KA3 => ECO:0000269|PubMed:22827337 source Swiss-Prot : SWS_FT_FI1 39) chain J residue 127 type MOD_RES sequence R description Phosphoserine; by RPS6KA3 => ECO:0000269|PubMed:22827337 source Swiss-Prot : SWS_FT_FI1 40) chain A residue 41-51 type prosite sequence RNLLSVAYKNV description 1433_1 14-3-3 proteins signature 1. RNLLSVAYKNV source prosite : PS00796 41) chain A residue 211-230 type prosite sequence YKDSTLIMQLLRDNLTLWTS description 1433_2 14-3-3 proteins signature 2. YKDSTLIMQLLRDNLTLWTS source prosite : PS00797

Display surface Download Links