eF-site ID 6ex9-A
PDB Code 6ex9
Chain A

click to enlarge
Title Crystal Structure of HIV-1 Integrase Catalytic Core Domain with Inhibitor Peptide
Classification VIRAL PROTEIN
Compound Integrase
Source (6EX9)
Sequence A:  SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQE
TAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIK
QEFQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHN
KKRKGYSAGERIVDIIATDI
Description (1)  Integrase, Inhibitor Peptide

Display surface

Download
Links