eF-site ID 6efu-A PDB Code 6efu Chain A click to enlarge Title Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum Classification HYDROLASE Compound Beta-glucosidase Source (A0A127SA86_TRIHA) Sequence A:  HMLPKDFQWGFATAAYQIEGAIDKDGRGPSIWDTFCAIPG KIADGTSGVTACDSYNRTAEDIALLKSLGAKSYRFSISWS RIIPKGGRDDPVNQLGIDHYAQFVDDLLEAGITPFITLFH WDLPEELHQRYGGLLNRTEFPLDFENYARVMFKALPKVRN WITFNEPWCSAILGYGSGTFAPGRQSTTEPWIVGHNLLVA HGRAVKVYRDEFKDLNDGQIGIVLNGDFTYPWDSSDPLDR EAAERRLEFFTAWYADPIYLGDYPASMRKQLGDRLPEFTP EEKAFVLGSNDFYGMNHYTSNYIRHRTSPATADDTVGNVD VLFYNKEGQCIGPETESSWLRPCPAGFRDFLVWISKRYNY PKIYVTENGTSLKGENDLPKEKILEDDFRVNYYNEYIRAM FTAATLDGVNVKGYFAWSLMDNFEWADGYVTRFGVTYVDY ENGQQRFPKKSAKSLKPLFDELIAK Description Functional site 1) chain A residue 338 type sequence W description binding site for residue NO3 A 501 source : AC1 2) chain A residue 297 type sequence Y description binding site for residue NO3 A 502 source : AC2 3) chain A residue 366 type sequence E description binding site for residue NO3 A 502 source : AC2 4) chain A residue 416 type sequence W description binding site for residue NO3 A 502 source : AC2 5) chain A residue 423 type sequence E description binding site for residue NO3 A 502 source : AC2 6) chain A residue 432 type sequence F description binding site for residue NO3 A 502 source : AC2 7) chain A residue 6-20 type prosite sequence FQWGFATAAYQIEGA description GLYCOSYL_HYDROL_F1_2 Glycosyl hydrolases family 1 N-terminal signature. FqWGfAtAAYQiEgA source prosite : PS00653

Display surface Download Links