eF-site ID 6ef1-L PDB Code 6ef1 Chain L click to enlarge Title Yeast 26S proteasome bound to ubiquitinated substrate (5D motor state) Classification MOTOR PROTEIN Compound Proteasome subunit alpha type-1 Source (6EF1) Sequence L:  LVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPE IFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIF SPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDA IGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDT LDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTG EFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINP DDLMKAVRKVAEVKKLEGTIEYQK Description Functional site 1) chain L residue 183 type sequence I description binding site for residue ADP L 501 source : AC5 2) chain L residue 225 type sequence G description binding site for residue ADP L 501 source : AC5 3) chain L residue 226 type sequence T description binding site for residue ADP L 501 source : AC5 4) chain L residue 227 type sequence G description binding site for residue ADP L 501 source : AC5 5) chain L residue 228 type sequence K description binding site for residue ADP L 501 source : AC5 6) chain L residue 229 type sequence T description binding site for residue ADP L 501 source : AC5 7) chain L residue 230 type sequence L description binding site for residue ADP L 501 source : AC5 8) chain L residue 360 type sequence I description binding site for residue ADP L 501 source : AC5 9) chain L residue 364 type sequence H description binding site for residue ADP L 501 source : AC5 10) chain L residue 388 type sequence G description binding site for residue ADP L 501 source : AC5 11) chain L residue 389 type sequence A description binding site for residue ADP L 501 source : AC5 12) chain L residue 392 type sequence R description binding site for residue ADP L 501 source : AC5 13) chain L residue 321-339 type prosite sequence TKIIMATNRPDTLDPALLR description AAA AAA-protein family signature. TkIImATNrpdtLDpALl.R source prosite : PS00674

Display surface Download Links