eF-site ID 6ef1-M PDB Code 6ef1 Chain M click to enlarge Title Yeast 26S proteasome bound to ubiquitinated substrate (5D motor state) Classification MOTOR PROTEIN Compound Proteasome subunit alpha type-1 Source (6EF1) Sequence M:  DEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGI RAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLV QMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFD SEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDV LDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDD DINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKH EDFVEGISEVQARKSKSVSFYA Description Functional site 1) chain M residue 224 type sequence P description binding site for residue ADP M 501 source : AC6 2) chain M residue 225 type sequence G description binding site for residue ADP M 501 source : AC6 3) chain M residue 226 type sequence T description binding site for residue ADP M 501 source : AC6 4) chain M residue 227 type sequence G description binding site for residue ADP M 501 source : AC6 5) chain M residue 228 type sequence K description binding site for residue ADP M 501 source : AC6 6) chain M residue 360 type sequence I description binding site for residue ADP M 501 source : AC6 7) chain M residue 321-339 type prosite sequence VKVLAATNRVDVLDPALLR description AAA AAA-protein family signature. VkVLaATNrvdvLDpALl.R source prosite : PS00674 8) chain M residue 222 type BINDING sequence G description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 9) chain M residue 180 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links