eF-site ID 6eer-D
PDB Code 6eer
Chain D

click to enlarge
Title Structure of glycine-bound GoxA from Pseudoalteromonas luteoviolacea
Classification UNKNOWN FUNCTION
Compound GoxA
Source (A0A161XU12_9GAMM)
Sequence D:  CQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNV
QYLVTQQELEQLLEEAFGGNVINEISQIKTKLDEKFKQEE
IETITGLLGLSHLVPQQQLSRSLDNLEDDIVQQIKGALLK
VLSDHYLHAVKKQAQNFYIYKCDNPVEKLKLTDGDKVTWR
VEVANKKSFWYDYNNALDLSLHTQGSGNLSKNVSKHRLAP
AMTAKRRNPNVITNSLRKQLVISSQGSVSSDNNTQVPLRG
KFPANERHNVLQGSIECDNEGVLRFYAGNGISQALSPSSL
NTDFADNSNWFDDICDGRVTAVVELKNGDTFEIQDEQSSA
WVATTPPDYAPQIEPIVTMYDMVSGAALKEQDLDNLTTQF
SDVFPILYRLYRMQWVNQADFTDNAVNTQIRELNSELGFA
QLLDNSASAKSLREGIFNQFRNPLFDQDIDVDDPGQSSNE
WVSNSRIIPSKDETNIAAKPATSSLKLPFYPNDGIDYPGS
PVQWFAIPPFMYQHLQNWAAGDFSVTQVEKESANTIEELG
LFYSEQFKNSPNSALLCARGALDALYGGGFHPGVELTWPM
RHNLIYSQNDYVSSVTPEINLLGLREFRLKQDLQGLNSPN
MYQDFGHVIAVDNVTASIDPNSDAAWLWRSTPGDLTKWMG
IPWQSDAASCQAVYTPEDFPIPSWXAANLPVHVLPLARYN
KFKDSQSADLPEINGMTHSIAQGMSEETFEHLRLEQFSQR
LDWLHTADLGFVGYHAEGGYTNGLIQMVSQWKNMAMVMAR
PVENPGSSGIPNVVYVAYSQADKD
Description (1)  GoxA


Functional site

1) chain D
residue 785
type
ligand
sequence N
description binding site for residue PGE A 903
source : AC3

2) chain D
residue 222
type
ligand
sequence K
description binding site for residue PEG C 903
source : AC8

3) chain D
residue 360
type
ligand
sequence D
description binding site for residue MG D 901
source : AC9

4) chain D
residue 362
type
ligand
sequence A
description binding site for residue MG D 901
source : AC9

5) chain D
residue 365
type
ligand
sequence I
description binding site for residue MG D 901
source : AC9

6) chain D
residue 699
type
ligand
sequence A
description binding site for residue MG D 901
source : AC9

7) chain D
residue 700
type
ligand
sequence N
description binding site for residue MG D 901
source : AC9

8) chain D
residue 438
type
ligand
sequence S
description binding site for residue NA D 902
source : AD1

9) chain D
residue 440
type
ligand
sequence S
description binding site for residue NA D 902
source : AD1

10) chain D
residue 491
type
ligand
sequence K
description binding site for residue EDO D 903
source : AD2

11) chain D
residue 492
type
ligand
sequence P
description binding site for residue EDO D 903
source : AD2

12) chain D
residue 493
type
ligand
sequence A
description binding site for residue EDO D 903
source : AD2

13) chain D
residue 766-767
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence YH
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_A_697

14) chain D
residue 782
type binding
ligand PGE: TRIETHYLENE GLYCOL
sequence Q
description TRIETHYLENE GLYCOL binding site
source pdb_hetatom : PGE_6eer_A_903

15) chain D
residue 785
type binding
ligand PGE: TRIETHYLENE GLYCOL
sequence N
description TRIETHYLENE GLYCOL binding site
source pdb_hetatom : PGE_6eer_A_903

16) chain D
residue 812
type binding
ligand PGE: TRIETHYLENE GLYCOL
sequence Q
description TRIETHYLENE GLYCOL binding site
source pdb_hetatom : PGE_6eer_A_903

17) chain D
residue 316
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence F
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_D_697

18) chain D
residue 578
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence Y
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_D_697

19) chain D
residue 580-586
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence GGFHPGV
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_D_697

20) chain D
residue 678
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence D
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_D_697

21) chain D
residue 681-682
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence SC
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_D_697

22) chain D
residue 695-696
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence SW
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_D_697

23) chain D
residue 698-702
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence AANLP
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_D_697

24) chain D
residue 772
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence Y
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_D_697

25) chain D
residue 222
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence K
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6eer_C_903

26) chain D
residue 490-493
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence AKPA
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6eer_D_903

27) chain D
residue 689
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence E
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6eer_D_903


Display surface

Download
Links