eF-site ID 6eer-C
PDB Code 6eer
Chain C

click to enlarge
Title Structure of glycine-bound GoxA from Pseudoalteromonas luteoviolacea
Classification UNKNOWN FUNCTION
Compound GoxA
Source (A0A161XU12_9GAMM)
Sequence C:  CQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNV
QYLVTQQELEQLLEEAFGNVINEISQIKTKLFKQEEIETI
TGLLGLSHLVPQQQLSRSLDNLIVQQIKGALLKVLSDHYL
HAVKKQAQNFYIYKCDNPVEKLKLTDGDKVTWRVEVANKK
SFWYDYNNALDLSLHTQGSGNLSKNVSKHRLAPAMTAKRR
NPNVITNSLRKQLVISSQGSVSSDNNTQVPLRGKFPANER
HNVLQGSIECDNEGVLRFYAGNGISQALSPSSLNTDFADN
SNWFDDICDGRVTAVVELKNGDTFEIQDEQSSAWVATTPP
DYAPQIEPIVTMYDMVSGAALKEQDLDNLTTQFSDVFPIL
YRLYRMQWVNQADFTDNAVNTQIRELNSELGFAQLLDNSA
SAKSLREGIFNQFRNPLFDQDIDVDDPGQSSNEWVSNSRI
IPSKDETNIAAKPATSSLKLPFYPNDGIDYPGSPVQWFAI
PPFMYQHLQNWAAGDFSVTQVEKESANTIEELGLFYSEQF
KNSPNSALLCARGALDALYGGGFHPGVELTWPMRHNLIYS
QNDYVSSVTPEINLLGLREFRLKQDLQGLNSPNMYQDFGH
VIAVDNVTASIDPNSDAAWLWRSTPGDLTKWMGIPWQSDA
ASCQAVYTPEDFPIPSWXAANLPVHVLPLARYNKFKDSQS
ADLPEINGMTHSIAQGMSEETFEHLRLEQFSQRLDWLHTA
DLGFVGYHAEGGYTNGLIQMVSQWKNMAMVMARPVENPGS
SGIPNVVYVAYSQADKD
Description (1)  GoxA


Functional site

1) chain C
residue 360
type
ligand
sequence D
description binding site for residue MG C 901
source : AC6

2) chain C
residue 362
type
ligand
sequence A
description binding site for residue MG C 901
source : AC6

3) chain C
residue 365
type
ligand
sequence I
description binding site for residue MG C 901
source : AC6

4) chain C
residue 699
type
ligand
sequence A
description binding site for residue MG C 901
source : AC6

5) chain C
residue 700
type
ligand
sequence N
description binding site for residue MG C 901
source : AC6

6) chain C
residue 438
type
ligand
sequence S
description binding site for residue NA C 902
source : AC7

7) chain C
residue 440
type
ligand
sequence S
description binding site for residue NA C 902
source : AC7

8) chain C
residue 190
type
ligand
sequence Y
description binding site for residue PEG C 903
source : AC8

9) chain C
residue 191
type
ligand
sequence N
description binding site for residue PEG C 903
source : AC8

10) chain C
residue 315
type
ligand
sequence D
description binding site for residue PEG C 903
source : AC8

11) chain C
residue 316
type
ligand
sequence F
description binding site for residue PEG C 903
source : AC8

12) chain C
residue 318
type
ligand
sequence D
description binding site for residue PEG C 903
source : AC8

13) chain C
residue 766-767
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence YH
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

14) chain C
residue 316
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence F
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

15) chain C
residue 507
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence I
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

16) chain C
residue 578
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence Y
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

17) chain C
residue 580-586
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence GGFHPGV
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

18) chain C
residue 678
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence D
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

19) chain C
residue 681-682
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence SC
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

20) chain C
residue 695-696
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence SW
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

21) chain C
residue 698-702
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence AANLP
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

22) chain C
residue 772
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence Y
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697

23) chain C
residue 189-192
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence DYNN
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6eer_C_903

24) chain C
residue 219
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence M
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6eer_C_903

25) chain C
residue 315-318
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence DFAD
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6eer_C_903

26) chain C
residue 508
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence D
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6eer_C_903


Display surface

Download
Links