eF-site ID 6eer-B
PDB Code 6eer
Chain B

click to enlarge
Title Structure of glycine-bound GoxA from Pseudoalteromonas luteoviolacea
Classification UNKNOWN FUNCTION
Compound GoxA
Source (A0A161XU12_9GAMM)
Sequence B:  CQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNV
QYLVTQQELEQLLEEAFGGNVINEISQIKTKLDERKKFKQ
EEIETITGLLGLSHLVPQQQLSRSLDNLELKDIVQQIKGA
LLKVLSDHYLHAVKKQAQNFYIYKCDNPVEKLKLTDGDKV
TWRVEVANKKSFWYDYNNALDLSLHTQGSGNLSKNVSKHR
LAPAMTAKRRNPNVITNSLRKQLVISSQGSVSSDNNTQVP
LRGKFPAERHNVLQGSIECDNEGVLRFYAGNGISQALSPS
SLNTDFADNSNWFDDICDGRVTAVVELKNGDTFEIQDEQS
SAWVATTPPDYAPQIEPIVTMYDMVSGAALKEQDLDNLTT
QFSDVFPILYRLYRMQWVNQADFTDNAVNTQIRELNSELG
FAQLLDNSASAKSLREGIFNQFRNPLFDQDIDVDDPGQSS
NEWVSNSRIIPSKDETNIAAKPATSSLKLPFYPNDGIDYP
GSPVQWFAIPPFMYQHLQNWAAGDFSVTQVEKESANTIEE
LGLFYSEQFKNSPNSALLCARGALDALYGGGFHPGVELTW
PMRHNLIYSQNDYVSSVTPEINLLGLREFRLKQDLQGLNS
PNMYQDFGHVIAVDNVTASIDPNSDAAWLWRSTPGDLTKW
MGIPWQSDAASCQAVYTPEDFPIPSWXAANLPVHVLPLAR
YNKFKDSQSADLPEINGMTHSIAQGMSEETFEHLRLEQFS
QRLDWLHTADLGFVGYHAEGGYTNGLIQMVSQWKNMAMVM
ARPVENPGSSGIPNVVYVAYSQADKD
Description (1)  GoxA


Functional site

1) chain B
residue 360
type
ligand
sequence D
description binding site for residue MG B 901
source : AC4

2) chain B
residue 362
type
ligand
sequence A
description binding site for residue MG B 901
source : AC4

3) chain B
residue 365
type
ligand
sequence I
description binding site for residue MG B 901
source : AC4

4) chain B
residue 699
type
ligand
sequence A
description binding site for residue MG B 901
source : AC4

5) chain B
residue 700
type
ligand
sequence N
description binding site for residue MG B 901
source : AC4

6) chain B
residue 438
type
ligand
sequence S
description binding site for residue NA B 902
source : AC5

7) chain B
residue 440
type
ligand
sequence S
description binding site for residue NA B 902
source : AC5

8) chain B
residue 278-279
type binding
ligand PGE: TRIETHYLENE GLYCOL
sequence ER
description TRIETHYLENE GLYCOL binding site
source pdb_hetatom : PGE_6eer_A_903

9) chain B
residue 316
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence F
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

10) chain B
residue 507
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence I
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

11) chain B
residue 578
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence Y
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

12) chain B
residue 580-586
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence GGFHPGV
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

13) chain B
residue 678
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence D
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

14) chain B
residue 681-682
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence SC
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

15) chain B
residue 695-696
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence SW
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

16) chain B
residue 698-702
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence AANLP
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

17) chain B
residue 772
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence Y
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_B_697

18) chain B
residue 766-767
type binding
ligand TNQ: 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan
sequence YH
description 6-[(carboxymethyl)amino]-7-hydroxy-L-tryptophan binding site
source pdb_hetatom : TNQ_6eer_C_697


Display surface

Download
Links