eF-site ID 6e67-A PDB Code 6e67 Chain A click to enlarge Title Structure of beta2 adrenergic receptor fused to a Gs peptide Classification MEMBRANE PROTEIN Compound Beta-2 adrenergic receptor,Endolysin,Guanine nucleotide-binding protein G(s) subunit alpha isoforms short,Beta-2 adrenergic receptor chimera Source (ADRB2_HUMAN) Sequence A:  DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVT NYFITSLACADLVMGLAVVPFGAAHILTKTWTFGNFWCEF WTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKN KARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEE TCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQECKR QLQKNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSP SLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRG ILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNS LRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGT WDAYDIIQRMHLRQYELCGTGEHKALKTLGIIMGTFTLCW LPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIY CRSPDFRIAFQELLCLR Description Functional site 1) chain A residue 109 type sequence W description binding site for residue P0G A 3101 source : AC1 2) chain A residue 110 type sequence T description binding site for residue P0G A 3101 source : AC1 3) chain A residue 113 type sequence D description binding site for residue P0G A 3101 source : AC1 4) chain A residue 114 type sequence V description binding site for residue P0G A 3101 source : AC1 5) chain A residue 193 type sequence F description binding site for residue P0G A 3101 source : AC1 6) chain A residue 200 type sequence A description binding site for residue P0G A 3101 source : AC1 7) chain A residue 203 type sequence S description binding site for residue P0G A 3101 source : AC1 8) chain A residue 204 type sequence S description binding site for residue P0G A 3101 source : AC1 9) chain A residue 207 type sequence S description binding site for residue P0G A 3101 source : AC1 10) chain A residue 293 type sequence N description binding site for residue P0G A 3101 source : AC1 11) chain A residue 308 type sequence Y description binding site for residue P0G A 3101 source : AC1 12) chain A residue 309 type sequence I description binding site for residue P0G A 3101 source : AC1 13) chain A residue 312 type sequence N description binding site for residue P0G A 3101 source : AC1 14) chain A residue 96-106 type TOPO_DOM sequence TKTWTFGNFWC description Extracellular source Swiss-Prot : SWS_FT_FI1 15) chain A residue 175-196 type TOPO_DOM sequence RATHQEAINCYAEETCCDFFTN description Extracellular source Swiss-Prot : SWS_FT_FI1 16) chain A residue 299-305 type TOPO_DOM sequence QDNLIRK description Extracellular source Swiss-Prot : SWS_FT_FI1 17) chain A residue 35-58 type TRANSMEM sequence GMGIVMSLIVLAIVFGNVLVITAI description Helical; Name=1 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 59-71 type TOPO_DOM sequence AKFERLQTVTNYF description Cytoplasmic source Swiss-Prot : SWS_FT_FI3 19) chain A residue 130-150 type TOPO_DOM sequence DRYFAITSPFKYQSLLTKNKA description Cytoplasmic source Swiss-Prot : SWS_FT_FI3 20) chain A residue 72-95 type TRANSMEM sequence ITSLACADLVMGLAVVPFGAAHIL description Helical; Name=2 source Swiss-Prot : SWS_FT_FI4 21) chain A residue 107-129 type TRANSMEM sequence EFWTSIDVLCVTASIETLCVIAV description Helical; Name=3 source Swiss-Prot : SWS_FT_FI5 22) chain A residue 151-174 type TRANSMEM sequence RVIILMVWIVSGLTSFLPIQMHWY description Helical; Name=4 source Swiss-Prot : SWS_FT_FI6 23) chain A residue 197-220 type TRANSMEM sequence QAYAIASSIVSFYVPLVIMVFVYS description Helical; Name=5 source Swiss-Prot : SWS_FT_FI7 24) chain A residue 275-298 type TRANSMEM sequence LGIIMGTFTLCWLPFFIVNIVHVI description Helical; Name=6 source Swiss-Prot : SWS_FT_FI8 25) chain A residue 306-329 type TRANSMEM sequence EVYILLNWIGYVNSGFNPLIYCRS description Helical; Name=7 source Swiss-Prot : SWS_FT_FI9 26) chain A residue 113 type BINDING sequence D description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 27) chain A residue 118 type BINDING sequence T description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 28) chain A residue 293 type BINDING sequence N description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 29) chain A residue 312 type BINDING sequence N description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 30) chain A residue 316 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:18547522, ECO:0007744|PDB:3D4S source Swiss-Prot : SWS_FT_FI10 31) chain A residue 203 type BINDING sequence S description BINDING => ECO:0000269|PubMed:17952055, ECO:0000269|PubMed:17962520, ECO:0007744|PDB:2RH1 source Swiss-Prot : SWS_FT_FI11 32) chain A residue 141 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:8521811 source Swiss-Prot : SWS_FT_FI12 33) chain A residue 341 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000269|PubMed:17962520, ECO:0000269|PubMed:18547522, ECO:0000269|PubMed:2540197, ECO:0000269|PubMed:27481942 source Swiss-Prot : SWS_FT_FI15 34) chain A residue 119-135 type prosite sequence ASIETLCVIAVDRYFAI description G_PROTEIN_RECEP_F1_1 G-protein coupled receptors family 1 signature. ASIeTLCVIAVDRYFaI source prosite : PS00237

Display surface Download Links