eF-site ID 6e3e-A
PDB Code 6e3e
Chain A

click to enlarge
Title Structure of RORgt in complex with a novel inverse agonist.
Classification nuclear protein/agonist
Compound Nuclear receptor ROR-gamma
Source (RORG_HUMAN)
Sequence A:  ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREE
VTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMEL
CQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGG
MELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALV
LINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA
KLPPKGKLRSLCSQHVE
Description (1)  Nuclear receptor ROR-gamma


Functional site

1) chain A
residue 451
type
ligand
sequence H
description binding site for residue SO4 A 501
source : AC1

2) chain A
residue 463
type
ligand
sequence L
description binding site for residue SO4 A 501
source : AC1

3) chain A
residue 290
type
ligand
sequence E
description binding site for residue MPD A 502
source : AC2

4) chain A
residue 304
type
ligand
sequence E
description binding site for residue MPD A 502
source : AC2

5) chain A
residue 308
type
ligand
sequence Y
description binding site for residue MPD A 502
source : AC2

6) chain A
residue 311
type
ligand
sequence K
description binding site for residue MPD A 502
source : AC2

7) chain A
residue 286
type
ligand
sequence Q
description binding site for residue HQ7 A 503
source : AC3

8) chain A
residue 320
type
ligand
sequence C
description binding site for residue HQ7 A 503
source : AC3

9) chain A
residue 323
type
ligand
sequence H
description binding site for residue HQ7 A 503
source : AC3

10) chain A
residue 324
type
ligand
sequence L
description binding site for residue HQ7 A 503
source : AC3

11) chain A
residue 361
type
ligand
sequence V
description binding site for residue HQ7 A 503
source : AC3

12) chain A
residue 364
type
ligand
sequence R
description binding site for residue HQ7 A 503
source : AC3

13) chain A
residue 365
type
ligand
sequence M
description binding site for residue HQ7 A 503
source : AC3

14) chain A
residue 368
type
ligand
sequence A
description binding site for residue HQ7 A 503
source : AC3

15) chain A
residue 377
type
ligand
sequence F
description binding site for residue HQ7 A 503
source : AC3

16) chain A
residue 378
type
ligand
sequence F
description binding site for residue HQ7 A 503
source : AC3

17) chain A
residue 379
type
ligand
sequence E
description binding site for residue HQ7 A 503
source : AC3


Display surface

Download
Links