eF-site ID 6e32-.A3
PDB Code 6e32
Chain A3

click to enlarge
Title Capsid protein of PCV2 with N,O6-DISULFO-GLUCOSAMINE
Classification VIRUS LIKE PARTICLE
Compound Capsid protein of PCV2
Source (Q805N7_PCV2)
Sequence A3:  GIFNTRLSRTFGYTIKRTTVKTPSWAVDMMRFNINDFLPP
GGGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSA
VILDDNFVTKATALTYDPYVNYSSRHTITQPFSYHSRYFT
PKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTAF
ENSIYDQEYNIRVTMYVQFREFNLKDPPL
Description (1)  Putative capsid protein

Display surface

Download
Links