eF-site ID 6dqx-A
PDB Code 6dqx
Chain A

click to enlarge
Title Actinobacillus ureae class Id ribonucleotide reductase alpha subunit
Classification OXIDOREDUCTASE
Compound Ribonucleoside-diphosphate reductase, alpha chain
Source (E8KJ17_9PAST)
Sequence A:  TRPDFEWLNEDSRLFLQRGYLLEGTTALERIRFIAEHAEH
KLGIEGYADKFYHYMARGYFSLSSPIWSNFGLDRGLPISC
FGSYIGDSIHEIMVTTAEVGMMSKIGGGTSAYFGDIRPRG
SAIKSDGSFNFSKLFDTVIDVISQGQFAGYIDIEHGDIDE
WLDIHTEGNPIQLMYYGVCVGHDWLESMKAGDPYKRQLWA
KLLQRKTETGIPYLFFKDNANAGRPDVYKDKNMTVHASNL
CTEIMLPSSNDESFVCCLSSMNLLYFDEWKDTEAPEVLTY
FLDVVMSEFIEKSKDMPFLDRAHRFATRHRALGLGVLGWH
SYLQANNIAFDSFQAMQKNNLIFKTLQEKTLKASQELAKR
FGEPEILKGYGRRNTTLMSIAPTKSSSFILGSVSPSVEPF
KSNYYYKNPFLEKLLQEKGLDTEEIWESILHNDGSVQHLE
QLTDEEKEVFKTFSEISQLSVIQQAAQRQKYIDQGQSINI
MVHPATPARDLNQLYLTAEELGLKSIYYQYSMSANLLSCS
Description (1)  Ribonucleoside-diphosphate reductase, alpha chain (E.C.1.17.4.1)


Functional site

1) chain A
residue 85
type
ligand
sequence C
description binding site for residue CL A 601
source : AC1

2) chain A
residue 86
type
ligand
sequence F
description binding site for residue CL A 601
source : AC1

3) chain A
residue 114
type
ligand
sequence T
description binding site for residue CL A 601
source : AC1

4) chain A
residue 115
type
ligand
sequence S
description binding site for residue CL A 601
source : AC1

5) chain A
residue 253
type
ligand
sequence N
description binding site for residue CL A 601
source : AC1

6) chain A
residue 254
type
ligand
sequence L
description binding site for residue CL A 601
source : AC1

7) chain A
residue 240
type
ligand
sequence D
description binding site for residue CL A 602
source : AC2

8) chain A
residue 241
type
ligand
sequence V
description binding site for residue CL A 602
source : AC2

9) chain A
residue 386
type
ligand
sequence R
description binding site for residue CL A 602
source : AC2

10) chain A
residue 45
type
ligand
sequence H
description binding site for residue MG A 604
source : AC4

11) chain A
residue 46
type
ligand
sequence K
description binding site for residue EDO A 605
source : AC5

12) chain A
residue 297
type
ligand
sequence D
description binding site for residue EDO A 605
source : AC5

13) chain A
residue 301
type
ligand
sequence S
description binding site for residue EDO A 605
source : AC5

14) chain A
residue 324
type
ligand
sequence R
description binding site for residue EDO A 605
source : AC5

15) chain A
residue 387
type
ligand
sequence R
description binding site for residue EDO A 605
source : AC5

16) chain A
residue 167
type
ligand
sequence I
description binding site for residue EDO A 606
source : AC6

17) chain A
residue 168
type
ligand
sequence E
description binding site for residue EDO A 606
source : AC6

18) chain A
residue 172
type
ligand
sequence I
description binding site for residue EDO A 606
source : AC6

19) chain A
residue 198
type
ligand
sequence W
description binding site for residue EDO A 606
source : AC6

20) chain A
residue 208
type
ligand
sequence Y
description binding site for residue EDO A 606
source : AC6

21) chain A
residue 212
type
ligand
sequence L
description binding site for residue EDO A 606
source : AC6

22) chain A
residue 92
type
ligand
sequence D
description binding site for residue EDO A 607
source : AC7

23) chain A
residue 122
type
ligand
sequence R
description binding site for residue EDO A 607
source : AC7

24) chain A
residue 173
type
ligand
sequence D
description binding site for residue EDO A 608
source : AC8

25) chain A
residue 177
type
ligand
sequence D
description binding site for residue EDO A 608
source : AC8

26) chain A
residue 244
type
ligand
sequence D
description binding site for residue GOL A 609
source : AC9

27) chain A
residue 46-47
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence KL
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_605

28) chain A
residue 297-298
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence DV
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_605

29) chain A
residue 301
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence S
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_605

30) chain A
residue 324
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_605

31) chain A
residue 375
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_605

32) chain A
residue 387
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_605

33) chain A
residue 92-94
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence DSI
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_607

34) chain A
residue 97
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence I
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_607

35) chain A
residue 121-122
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence IR
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_607

36) chain A
residue 128
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence I
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_607

37) chain A
residue 134
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence S
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_607

38) chain A
residue 140
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_607

39) chain A
residue 167-169
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence IEH
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_606

40) chain A
residue 172
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence I
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_606

41) chain A
residue 198
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence W
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_606

42) chain A
residue 208-209
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence YK
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_606

43) chain A
residue 212
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_606

44) chain A
residue 173-174
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence DE
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_608

45) chain A
residue 177
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence D
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_608

46) chain A
residue 183
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6dqx_A_608

47) chain A
residue 240
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_6dqx_A_609

48) chain A
residue 243-244
type binding
ligand GOL: GLYCEROL
sequence KD
description GLYCEROL binding site
source pdb_hetatom : GOL_6dqx_A_609


Display surface

Download
Links