eF-site ID 6dn8-E PDB Code 6dn8 Chain E click to enlarge Title SPRY domain-containing SOCS box protein 2 complexed with (GZJ)VDINNN(CY3) Cyclic peptide inhibitor Classification IMMUNE SYSTEM/INHIBITOR Compound SPRY domain-containing SOCS box protein 4 Source (6DN8) Sequence E:  RPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDR LTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTH AVVGVATARAPLHSVGYTALVGSDAESWGWDLGRSRLYHD GKNQPGVAYPAFEAFALPDSLLVVLDMDEGTLSFIVDGQY LGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDP Description Functional site 1) chain E residue 50 type sequence V description binding site for residue ACT E 301 source : AC6 2) chain E residue 53 type sequence R description binding site for residue ACT E 301 source : AC6 3) chain E residue 54 type sequence H description binding site for residue ACT E 301 source : AC6 4) chain E residue 77 type sequence R description binding site for Di-peptide CY3 F 101 and ASN F 7 source : AD2 5) chain E residue 79 type sequence P description binding site for Di-peptide CY3 F 101 and ASN F 7 source : AD2 6) chain E residue 80 type sequence V description binding site for Di-peptide CY3 F 101 and ASN F 7 source : AD2 7) chain E residue 81 type sequence A description binding site for Di-peptide CY3 F 101 and ASN F 7 source : AD2 8) chain E residue 129 type sequence Y description binding site for Di-peptide CY3 F 101 and ASN F 7 source : AD2 9) chain E residue 216 type sequence V description binding site for Di-peptide CY3 F 101 and ASN F 7 source : AD2 10) chain E residue 218 type sequence G description binding site for Di-peptide CY3 F 101 and ASN F 7 source : AD2

Display surface Download Links