eF-site ID 6dhg-Z PDB Code 6dhg Chain Z click to enlarge Title RT XFEL structure of Photosystem II 150 microseconds after the second illumination at 2.5 Angstrom resolution Classification PHOTOSYNTHESIS Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus (strain BP-1); Sequence Z:  MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLI FLGSGLWIALVLVVGVLNFFVV Description Functional site 1) chain Z residue 20 type sequence V description binding site for residue CLA C 512 source : AH2 2) chain Z residue 16 type sequence S description binding site for residue BCR C 520 source : AI1 3) chain Z residue 16 type sequence S description binding site for residue BCR K 101 source : AJ9 4) chain Z residue 17 type sequence F description binding site for residue BCR K 101 source : AJ9 5) chain Z residue 54 type sequence V description binding site for residue BCR Z 101 source : AK5 6) chain Z residue 55 type sequence G description binding site for residue BCR Z 101 source : AK5 7) chain Z residue 58 type sequence N description binding site for residue BCR Z 101 source : AK5 8) chain Z residue 1 type MOD_RES sequence M description N-formylmethionine => ECO:0000269|PubMed:19219048, ECO:0000269|PubMed:20558739 source Swiss-Prot : SWS_FT_FI5 9) chain Z residue 5-25 type TRANSMEM sequence FQLALAALVILSFVMVIGVPV description Helical => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI2 10) chain Z residue 37-58 type TRANSMEM sequence KQLIFLGSGLWIALVLVVGVLN description Helical => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI2 11) chain Z residue 26-36 type TOPO_DOM sequence AYASPQDWDRS description Cytoplasmic => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI3 12) chain Z residue 59-62 type TOPO_DOM sequence FFVV description Lumenal => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI4

Display surface Download Links