eF-site ID 6dgu-D
PDB Code 6dgu
Chain D

click to enlarge
Title PER-2 class A extended-spectrum beta-lactamase crystal structure at 2.69 Angstrom resolution
Classification HYDROLASE
Compound Beta-lactamase
Source (A2RP81_CITFR)
Sequence D:  LLKEQIETIVTGKKATVGVAVWGPDDLEPLLLNPFEKFPM
QSVFKLHLAMLVLHQVDQGKLDLNQSVTVNRAAVLQNTWS
PMMKDHQGDEFTVAVQQLLQYSVSHSDNVACDLLFELVGG
PQALHAYIQSLGVKEAAVVANEAQMHADDQVQYQNWTSMK
AAAQVLQKFEQKKQLSETSQALLWKWMVETTTGPQRLKGL
LPAGTIVAHKTGTSGVRAGKTAATNDAGVIMLPDGRPLLV
AVFVKDSAESERTNEAIIAQVAQAAYQFELKK
Description (1)  Beta-lactamase (E.C.3.5.2.6)

Display surface

Download
Links