eF-site ID 6dgu-C
PDB Code 6dgu
Chain C

click to enlarge
Title PER-2 class A extended-spectrum beta-lactamase crystal structure at 2.69 Angstrom resolution
Classification HYDROLASE
Compound Beta-lactamase
Source (A2RP81_CITFR)
Sequence C:  SPLLKEQIETIVTGKKATVGVAVWGPDDLEPLLLNPFEKF
PMQSVFKLHLAMLVLHQVDQGKLDLNQSVTVNRAAVLQNT
WSPMMKDHQGDEFTVAVQQLLQYSVSHSDNVACDLLFELV
GGPQALHAYIQSLGVKEAAVVANEAQMHADDQVQYQNWTS
MKAAAQVLQKFEQKKQLSETSQALLWKWMVETTTGPQRLK
GLLPAGTIVAHKTGTSGVRAGKTAATNDAGVIMLPDGRPL
LVAVFVKDSAESERTNEAIIAQVAQAAYQFELKKL
Description (1)  Beta-lactamase (E.C.3.5.2.6)


Functional site

1) chain C
residue 66-81
type prosite
ligand
sequence FPMQSVFKLHLAMLVL
description Beta-lactamase class-A active site.[FY]-x-[LIVMFY]-{E}-S-[TV]-x-K-x(3)-{T}-[AGLM]-{D}-{KA}-[LC].
source prosite : PS00146


Display surface

Download
Links