eF-site ID 6df9-ADE
PDB Code 6df9
Chain A, D, E

click to enlarge
Title Kaiso (ZBTB33) E535Q zinc finger DNA binding domain in complex with the specific Kaiso binding sequence (KBS)
Classification DNA BINDING PROTEIN/DNA
Compound Transcriptional regulator Kaiso
Source (6DF9)
Sequence A:  DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKK
YPCRYCEKVFPLAQYRTKHEIHHTGERRYQCLACGKSFIN
YQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQY
D:  TGCTTCCTGCCAATAACG
E:  CGTTATTGGCAGGAAGCA
Description (1)  Transcriptional regulator Kaiso/DNA Complex


Functional site

1) chain A
residue 496
type
ligand
sequence C
description binding site for residue ZN A 701
source : AC1

2) chain A
residue 499
type
ligand
sequence C
description binding site for residue ZN A 701
source : AC1

3) chain A
residue 512
type
ligand
sequence H
description binding site for residue ZN A 701
source : AC1

4) chain A
residue 516
type
ligand
sequence H
description binding site for residue ZN A 701
source : AC1

5) chain A
residue 524
type
ligand
sequence C
description binding site for residue ZN A 702
source : AC2

6) chain A
residue 527
type
ligand
sequence C
description binding site for residue ZN A 702
source : AC2

7) chain A
residue 540
type
ligand
sequence H
description binding site for residue ZN A 702
source : AC2

8) chain A
residue 544
type
ligand
sequence H
description binding site for residue ZN A 702
source : AC2

9) chain A
residue 552
type
ligand
sequence C
description binding site for residue ZN A 703
source : AC3

10) chain A
residue 555
type
ligand
sequence C
description binding site for residue ZN A 703
source : AC3

11) chain A
residue 568
type
ligand
sequence H
description binding site for residue ZN A 703
source : AC3

12) chain A
residue 573
type
ligand
sequence H
description binding site for residue ZN A 703
source : AC3

13) chain A
residue 548
type
ligand
sequence R
description binding site for residue CL A 704
source : AC4

14) chain A
residue 548
type
ligand
sequence R
description binding site for residue CL A 704
source : AC4

15) chain A
residue 590
type
ligand
sequence R
description binding site for residue CL A 704
source : AC4

16) chain A
residue 590
type
ligand
sequence R
description binding site for residue CL A 704
source : AC4


Display surface

Download
Links