eF-site ID 6dat-D PDB Code 6dat Chain D click to enlarge Title ETS1 in complex with synthetic SRR mimic Classification DNA BINDING PROTEIN Compound Protein C-ets-1 Source (6DAT) Sequence D:  GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFL LELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNK PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL LGYTPEELHAMLDVK Description Functional site 1) chain D residue 405 type sequence T description binding site for residue SO4 A 502 source : AC2 2) chain D residue 406 type sequence A description binding site for residue SO4 A 502 source : AC2 3) chain D residue 311 type sequence R description binding site for residue SO4 D 501 source : AC8 4) chain D residue 316 type sequence K description binding site for residue SO4 D 501 source : AC8 5) chain D residue 373 type sequence R description binding site for residue SO4 D 501 source : AC8 6) chain D residue 374 type sequence R description binding site for residue SO4 D 501 source : AC8 7) chain D residue 377 type sequence K description binding site for residue SO4 D 501 source : AC8 8) chain D residue 335 type sequence I description binding site for residue SO4 D 502 source : AC9 9) chain D residue 379 type sequence K description binding site for residue SO4 D 502 source : AC9 10) chain D residue 335-415 type DNA_BIND sequence IQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARR WGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRF V description ETS => ECO:0000255|PROSITE-ProRule:PRU00237 source Swiss-Prot : SWS_FT_FI1 11) chain D residue 305 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P14921 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links