eF-site ID 6dat-B
PDB Code 6dat
Chain B

click to enlarge
Title ETS1 in complex with synthetic SRR mimic
Classification DNA BINDING PROTEIN
Compound Protein C-ets-1
Source (6DAT)
Sequence B:  GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFL
LELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNK
PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL
LGYTPEELHAMLDVK
Description (1)  Protein C-ets-1, SRR


Functional site

1) chain B
residue 335
type
ligand
sequence I
description binding site for residue SO4 B 501
source : AC4

2) chain B
residue 379
type
ligand
sequence K
description binding site for residue SO4 B 501
source : AC4

3) chain B
residue 311
type
ligand
sequence R
description binding site for residue SO4 B 502
source : AC5

4) chain B
residue 316
type
ligand
sequence K
description binding site for residue SO4 B 502
source : AC5

5) chain B
residue 374
type
ligand
sequence R
description binding site for residue SO4 B 502
source : AC5

6) chain B
residue 377
type
ligand
sequence K
description binding site for residue SO4 B 502
source : AC5

7) chain B
residue 406
type
ligand
sequence A
description binding site for residue SO4 C 502
source : AC7

8) chain B
residue 375
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

9) chain B
residue 381
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

10) chain B
residue 384
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence M
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

11) chain B
residue 388
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

12) chain B
residue 332
type binding
ligand NH2: AMINO GROUP
sequence S
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_E_297

13) chain B
residue 334-336
type binding
ligand NH2: AMINO GROUP
sequence PIQ
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_E_297

14) chain B
residue 379
type binding
ligand NH2: AMINO GROUP
sequence K
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_E_297


Display surface

Download
Links