eF-site ID 6dat-ABCDEF
PDB Code 6dat
Chain A, B, C, D, E, F

click to enlarge
Title ETS1 in complex with synthetic SRR mimic
Classification DNA BINDING PROTEIN
Compound Protein C-ets-1
Source (6DAT)
Sequence A:  GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFL
LELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNK
PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL
LGYTPEELHAMLDVK
B:  GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFL
LELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNK
PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL
LGYTPEELHAMLDVK
C:  GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFL
LELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNK
PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL
LGYTPEELHAMLDVK
D:  GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFL
LELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNK
PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL
LGYTPEELHAMLDVK
E:  PXXDXXDXEDXPAALWX
F:  PXXDXXDXEDXPAALWX
Description (1)  Protein C-ets-1, SRR


Functional site

1) chain A
residue 311
type
ligand
sequence R
description binding site for residue SO4 A 501
source : AC1

2) chain A
residue 316
type
ligand
sequence K
description binding site for residue SO4 A 501
source : AC1

3) chain A
residue 373
type
ligand
sequence R
description binding site for residue SO4 A 501
source : AC1

4) chain A
residue 374
type
ligand
sequence R
description binding site for residue SO4 A 501
source : AC1

5) chain A
residue 377
type
ligand
sequence K
description binding site for residue SO4 A 501
source : AC1

6) chain A
residue 400
type
ligand
sequence N
description binding site for residue SO4 A 502
source : AC2

7) chain D
residue 405
type
ligand
sequence T
description binding site for residue SO4 A 502
source : AC2

8) chain D
residue 406
type
ligand
sequence A
description binding site for residue SO4 A 502
source : AC2

9) chain A
residue 361
type
ligand
sequence W
description binding site for residue SO4 A 503
source : AC3

10) chain A
residue 415
type
ligand
sequence V
description binding site for residue SO4 A 503
source : AC3

11) chain A
residue 416
type
ligand
sequence C
description binding site for residue SO4 A 503
source : AC3

12) chain A
residue 417
type
ligand
sequence D
description binding site for residue SO4 A 503
source : AC3

13) chain B
residue 335
type
ligand
sequence I
description binding site for residue SO4 B 501
source : AC4

14) chain B
residue 379
type
ligand
sequence K
description binding site for residue SO4 B 501
source : AC4

15) chain C
residue 335
type
ligand
sequence I
description binding site for residue SO4 B 501
source : AC4

16) chain C
residue 379
type
ligand
sequence K
description binding site for residue SO4 B 501
source : AC4

17) chain B
residue 311
type
ligand
sequence R
description binding site for residue SO4 B 502
source : AC5

18) chain B
residue 316
type
ligand
sequence K
description binding site for residue SO4 B 502
source : AC5

19) chain B
residue 374
type
ligand
sequence R
description binding site for residue SO4 B 502
source : AC5

20) chain B
residue 377
type
ligand
sequence K
description binding site for residue SO4 B 502
source : AC5

21) chain C
residue 311
type
ligand
sequence R
description binding site for residue SO4 C 501
source : AC6

22) chain C
residue 316
type
ligand
sequence K
description binding site for residue SO4 C 501
source : AC6

23) chain C
residue 374
type
ligand
sequence R
description binding site for residue SO4 C 501
source : AC6

24) chain B
residue 406
type
ligand
sequence A
description binding site for residue SO4 C 502
source : AC7

25) chain C
residue 400
type
ligand
sequence N
description binding site for residue SO4 C 502
source : AC7

26) chain D
residue 311
type
ligand
sequence R
description binding site for residue SO4 D 501
source : AC8

27) chain D
residue 316
type
ligand
sequence K
description binding site for residue SO4 D 501
source : AC8

28) chain D
residue 373
type
ligand
sequence R
description binding site for residue SO4 D 501
source : AC8

29) chain D
residue 374
type
ligand
sequence R
description binding site for residue SO4 D 501
source : AC8

30) chain D
residue 377
type
ligand
sequence K
description binding site for residue SO4 D 501
source : AC8

31) chain A
residue 335
type
ligand
sequence I
description binding site for residue SO4 D 502
source : AC9

32) chain A
residue 379
type
ligand
sequence K
description binding site for residue SO4 D 502
source : AC9

33) chain D
residue 335
type
ligand
sequence I
description binding site for residue SO4 D 502
source : AC9

34) chain D
residue 379
type
ligand
sequence K
description binding site for residue SO4 D 502
source : AC9

35) chain A
residue 330
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence T
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

36) chain A
residue 332
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence S
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

37) chain A
residue 336
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Q
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

38) chain A
residue 338
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

39) chain A
residue 396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Y
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

40) chain A
residue 399
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

41) chain A
residue 401
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence I
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

42) chain A
residue 416
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence C
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

43) chain A
residue 418
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

44) chain A
residue 421
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

45) chain F
residue 281
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence P
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

46) chain F
residue 284
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

47) chain A
residue 336-338
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence QLW
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

48) chain A
residue 392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence G
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

49) chain A
residue 395-396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence YY
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

50) chain A
residue 399
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

51) chain A
residue 401
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence I
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

52) chain F
residue 284
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

53) chain F
residue 287
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

54) chain F
residue 292-293
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence PA
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

55) chain A
residue 337
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

56) chain A
residue 375
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

57) chain A
residue 384
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence M
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

58) chain A
residue 388-389
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence KL
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

59) chain A
residue 391-392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence RG
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

60) chain A
residue 395-396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence YY
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

61) chain F
residue 287
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

62) chain F
residue 289-290
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence ED
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

63) chain F
residue 292-293
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence PA
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

64) chain A
residue 380
type binding
ligand NH2: AMINO GROUP
sequence N
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_F_297

65) chain D
residue 332
type binding
ligand NH2: AMINO GROUP
sequence S
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_F_297

66) chain D
residue 334-336
type binding
ligand NH2: AMINO GROUP
sequence PIQ
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_F_297

67) chain D
residue 379
type binding
ligand NH2: AMINO GROUP
sequence K
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_F_297

68) chain E
residue 289
type binding
ligand NH2: AMINO GROUP
sequence E
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_F_297

69) chain F
residue 295-296
type binding
ligand NH2: AMINO GROUP
sequence LW
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_F_297

70) chain A
residue 392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence G
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

71) chain A
residue 395
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Y
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

72) chain B
residue 375
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

73) chain B
residue 381
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

74) chain B
residue 384
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence M
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

75) chain B
residue 388
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

76) chain E
residue 296
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

77) chain F
residue 287
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

78) chain F
residue 289-290
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence ED
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

79) chain F
residue 292-293
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence PA
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

80) chain B
residue 332
type binding
ligand NH2: AMINO GROUP
sequence S
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_E_297

81) chain B
residue 334-336
type binding
ligand NH2: AMINO GROUP
sequence PIQ
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_E_297

82) chain B
residue 379
type binding
ligand NH2: AMINO GROUP
sequence K
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_E_297

83) chain E
residue 295-296
type binding
ligand NH2: AMINO GROUP
sequence LW
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_E_297

84) chain F
residue 289
type binding
ligand NH2: AMINO GROUP
sequence E
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_E_297

85) chain C
residue 330
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence T
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

86) chain C
residue 332
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence S
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

87) chain C
residue 336
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Q
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

88) chain C
residue 338
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

89) chain C
residue 396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Y
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

90) chain C
residue 399
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

91) chain C
residue 401
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence I
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

92) chain C
residue 416
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence C
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

93) chain C
residue 418
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

94) chain C
residue 421
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

95) chain E
residue 281
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence P
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

96) chain E
residue 284
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_283

97) chain C
residue 336-338
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence QLW
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_286

98) chain C
residue 392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence G
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_286

99) chain C
residue 395-396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence YY
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_286

100) chain C
residue 399
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_286

101) chain C
residue 401
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence I
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_286

102) chain E
residue 284
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_286

103) chain E
residue 287
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_286

104) chain E
residue 292-293
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence PA
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_286

105) chain C
residue 337
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

106) chain C
residue 375
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

107) chain C
residue 384
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence M
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

108) chain C
residue 388-389
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence KL
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

109) chain C
residue 391-392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence RG
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

110) chain C
residue 395-396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence YY
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

111) chain E
residue 287
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

112) chain E
residue 289-290
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence ED
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

113) chain E
residue 292-293
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence PA
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_291

114) chain C
residue 392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence G
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

115) chain C
residue 395
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Y
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

116) chain D
residue 375
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

117) chain D
residue 381
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

118) chain D
residue 384
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence M
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

119) chain D
residue 388
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

120) chain E
residue 287
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence D
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

121) chain E
residue 289-290
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence ED
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

122) chain E
residue 292-293
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence PA
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288

123) chain F
residue 296
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_E_288


Display surface

Download
Links