eF-site ID 6dat-A
PDB Code 6dat
Chain A

click to enlarge
Title ETS1 in complex with synthetic SRR mimic
Classification DNA BINDING PROTEIN
Compound Protein C-ets-1
Source (6DAT)
Sequence A:  GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFL
LELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNK
PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL
LGYTPEELHAMLDVK
Description (1)  Protein C-ets-1, SRR


Functional site

1) chain A
residue 311
type
ligand
sequence R
description binding site for residue SO4 A 501
source : AC1

2) chain A
residue 316
type
ligand
sequence K
description binding site for residue SO4 A 501
source : AC1

3) chain A
residue 373
type
ligand
sequence R
description binding site for residue SO4 A 501
source : AC1

4) chain A
residue 374
type
ligand
sequence R
description binding site for residue SO4 A 501
source : AC1

5) chain A
residue 377
type
ligand
sequence K
description binding site for residue SO4 A 501
source : AC1

6) chain A
residue 400
type
ligand
sequence N
description binding site for residue SO4 A 502
source : AC2

7) chain A
residue 361
type
ligand
sequence W
description binding site for residue SO4 A 503
source : AC3

8) chain A
residue 415
type
ligand
sequence V
description binding site for residue SO4 A 503
source : AC3

9) chain A
residue 416
type
ligand
sequence C
description binding site for residue SO4 A 503
source : AC3

10) chain A
residue 417
type
ligand
sequence D
description binding site for residue SO4 A 503
source : AC3

11) chain A
residue 335
type
ligand
sequence I
description binding site for residue SO4 D 502
source : AC9

12) chain A
residue 379
type
ligand
sequence K
description binding site for residue SO4 D 502
source : AC9

13) chain A
residue 330
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence T
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

14) chain A
residue 332
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence S
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

15) chain A
residue 336
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Q
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

16) chain A
residue 338
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

17) chain A
residue 396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Y
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

18) chain A
residue 399
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

19) chain A
residue 401
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence I
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

20) chain A
residue 416
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence C
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

21) chain A
residue 418
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

22) chain A
residue 421
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_283

23) chain A
residue 336-338
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence QLW
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

24) chain A
residue 392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence G
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

25) chain A
residue 395-396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence YY
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

26) chain A
residue 399
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence K
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

27) chain A
residue 401
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence I
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_286

28) chain A
residue 337
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence L
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

29) chain A
residue 375
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence W
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

30) chain A
residue 384
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence M
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

31) chain A
residue 388-389
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence KL
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

32) chain A
residue 391-392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence RG
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

33) chain A
residue 395-396
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence YY
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_291

34) chain A
residue 380
type binding
ligand NH2: AMINO GROUP
sequence N
description AMINO GROUP binding site
source pdb_hetatom : NH2_6dat_F_297

35) chain A
residue 392
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence G
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288

36) chain A
residue 395
type binding
ligand PF5: 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE
sequence Y
description 2,3,4,5,6-PENTAFLUORO-L-PHENYLALANINE binding site
source pdb_hetatom : PF5_6dat_F_288


Display surface

Download
Links