eF-site ID 6d73-C
PDB Code 6d73
Chain C

click to enlarge
Title Cryo-EM structure of the zebrafish TRPM2 channel in the presence of Ca2+M2
Classification TRANSPORT PROTEIN
Compound Transient receptor potential cation channel, subfamily M
Source (6D73)
Sequence C:  LASWIKENIKKKEWDKHRHVRETPTDAFGDISFGGLGQKT
GKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKN
FYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVG
MAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGR
FPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEI
ELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNT
IYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALI
NRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVF
RIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELA
VAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEF
VRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKR
VQCLSHVSEEVRHLLGSFTQPLYIASRYKDTVWDPGRDLF
LWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQES
GEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKL
LIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWC
GELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAE
RTEQCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMI
DFQTSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRK
AKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKV
ILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFF
MFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYEPYIT
IFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTP
VFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDN
TDTIWKFQRYELIKEYHSRPALPPPFILLSHLILFIRGVF
LRHKNFRQELEQTEEEELLSWEAYMKDNYLASTRQDESQS
VEHRIHDTAEKVGAMSELLEREQEMVXXXXXXXXXXXXXX
XXXXXXXXDEEAPHMFARQLQYPDSTVRRFPVPEEKVSWE
VNFSPYQPPVYNQKHRNPGGRTGIRGKGALNTLGPNHILH
PIFTRWRDKVLEFLAVWRWALLGGPALAQVLERILGKKLN
EGEEVYKGYVDDSRNTDNAWVETSIITLHCDKNTMADLNH
MVELQWREVSSDACRCSYQREALRQIA
Description (1)  Transient receptor potential cation channel subfamily M member 8


Functional site

1) chain C
residue 857
type
ligand
sequence E
description binding site for residue CA C 1601
source : AC3

2) chain C
residue 860
type
ligand
sequence Q
description binding site for residue CA C 1601
source : AC3

3) chain C
residue 883
type
ligand
sequence N
description binding site for residue CA C 1601
source : AC3

4) chain C
residue 925
type
ligand
sequence R
description binding site for residue CA C 1601
source : AC3


Display surface

Download
Links