eF-site ID 6d73-B
PDB Code 6d73
Chain B

click to enlarge
Title Cryo-EM structure of the zebrafish TRPM2 channel in the presence of Ca2+
Classification TRANSPORT PROTEIN
Compound Transient receptor potential cation channel, subfamily M
Source (6D73)
Sequence B:  LASWIKENIKKKEQWDKHRHVRETPTDAFGDISFGGLGQK
TGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAK
NFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHV
GMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEG
RFPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVE
IELRARLEKLISKLSLGGVTIPVVCVVLDGGPGTLNTIYN
SMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRL
LKRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRID
EDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAW
NRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRL
LLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQE
PLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYDTVWDP
GRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRK
LAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQ
RAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALL
TQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDI
QRQAERTEQQKNCSSRLMSFLKSPQVKFYWNIASYFGFLW
LFAVVLMIDFQTSPSWRELLLYVWLTSLVCEEIRQLYHDG
FRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFY
IGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLD
LFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYE
PYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNA
DNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQE
VQDNTDTIWKFQRYELIKEYHSRPALPPPFILLSHLILFI
RGVFLRHKNFRQELEQTEEEELLSWEAYMKDNYLASTRQD
ESQSVEHRIHDTAEKVGAMSELLEREQEMVXXXXXXXXXX
XXXXXXXXXXXXEEAPHMFARQLQYPDSTVRRFPVPEEKV
SWEVNFSPYQPPVYNQQDKHRNPGGRTGIRGKGALNTLGP
NHILHPIFTRWRDAEHKVLEFLAVWEDAEKRWALLGGPAQ
PDLAQVLERILGKKLKTLLKAGEEVYKGYVDDSRNTDNAW
VETSIITLHTPLMADLNHMVESSLSSHQPLQWREVSSDAC
RCSYQREALRQIAHHH
Description (1)  Transient receptor potential cation channel subfamily M member 8


Functional site

1) chain B
residue 857
type
ligand
sequence E
description binding site for residue CA B 1601
source : AC1

2) chain B
residue 860
type
ligand
sequence Q
description binding site for residue CA B 1601
source : AC1

3) chain B
residue 883
type
ligand
sequence N
description binding site for residue CA B 1601
source : AC1

4) chain B
residue 886
type
ligand
sequence D
description binding site for residue CA B 1601
source : AC1

5) chain B
residue 925
type
ligand
sequence R
description binding site for residue CA B 1601
source : AC1


Display surface

Download
Links