eF-site ID 6d64-B
PDB Code 6d64
Chain B

click to enlarge
Title Crystal Structure of Human CD1b in Complex with POPC
Classification IMMUNE SYSTEM
Compound T-cell surface glycoprotein CD1b
Source (B2MG_HUMAN)
Sequence B:  PKIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVD
LLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEY
ACRVNHVTLSQPKIVKWDRD
Description (1)  T-cell surface glycoprotein CD1b, Beta-2-microglobulin


Functional site

1) chain B
residue 60
type
ligand
sequence K
description binding site for residue CL A 421
source : AC5

2) chain B
residue 34
type
ligand
sequence P
description binding site for residue EDO A 425
source : AC7

3) chain B
residue 45
type
ligand
sequence G
description binding site for residue CL B 201
source : AD3

4) chain B
residue 81
type
ligand
sequence A
description binding site for residue CL B 201
source : AD3

5) chain B
residue 88
type
ligand
sequence T
description binding site for residue EDO B 202
source : AD4

6) chain B
residue 89
type
ligand
sequence L
description binding site for residue EDO B 202
source : AD4

7) chain B
residue 90
type
ligand
sequence S
description binding site for residue EDO B 202
source : AD4

8) chain B
residue 91
type
ligand
sequence Q
description binding site for residue EDO B 202
source : AD4

9) chain B
residue 36
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence D
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_6d64_A_409

10) chain B
residue 34
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence P
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6d64_A_425

11) chain B
residue 88-91
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence TLSQ
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6d64_B_202

12) chain B
residue 93
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence K
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6d64_B_202


Display surface

Download
Links