eF-site ID 6d64-AB
PDB Code 6d64
Chain A, B

click to enlarge
Title Crystal Structure of Human CD1b in Complex with POPC
Classification IMMUNE SYSTEM
Compound T-cell surface glycoprotein CD1b
Source (B2MG_HUMAN)
Sequence A:  FQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSD
SGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQD
FAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDF
LSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLY
ETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQ
LVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTW
YLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRGSGLN
DI
B:  PKIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVD
LLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEY
ACRVNHVTLSQPKIVKWDRD
Description (1)  T-cell surface glycoprotein CD1b, Beta-2-microglobulin


Functional site

1) chain A
residue 66
type
ligand
sequence L
description binding site for residue POV A 417
source : AC1

2) chain A
residue 69
type
ligand
sequence I
description binding site for residue POV A 417
source : AC1

3) chain A
residue 72
type
ligand
sequence V
description binding site for residue POV A 417
source : AC1

4) chain A
residue 73
type
ligand
sequence Y
description binding site for residue POV A 417
source : AC1

5) chain A
residue 76
type
ligand
sequence G
description binding site for residue POV A 417
source : AC1

6) chain A
residue 100
type
ligand
sequence A
description binding site for residue POV A 417
source : AC1

7) chain A
residue 126
type
ligand
sequence V
description binding site for residue POV A 417
source : AC1

8) chain A
residue 129
type
ligand
sequence A
description binding site for residue POV A 417
source : AC1

9) chain A
residue 131
type
ligand
sequence C
description binding site for residue POV A 417
source : AC1

10) chain A
residue 148
type
ligand
sequence I
description binding site for residue POV A 417
source : AC1

11) chain A
residue 152
type
ligand
sequence Q
description binding site for residue POV A 417
source : AC1

12) chain A
residue 153
type
ligand
sequence G
description binding site for residue POV A 417
source : AC1

13) chain A
residue 154
type
ligand
sequence I
description binding site for residue POV A 417
source : AC1

14) chain A
residue 155
type
ligand
sequence M
description binding site for residue POV A 417
source : AC1

15) chain A
residue 157
type
ligand
sequence T
description binding site for residue POV A 417
source : AC1

16) chain A
residue 158
type
ligand
sequence V
description binding site for residue POV A 417
source : AC1

17) chain A
residue 161
type
ligand
sequence L
description binding site for residue POV A 417
source : AC1

18) chain A
residue 169
type
ligand
sequence Y
description binding site for residue POV A 417
source : AC1

19) chain A
residue 13
type
ligand
sequence I
description binding site for residue CUY A 418
source : AC2

20) chain A
residue 70
type
ligand
sequence F
description binding site for residue CUY A 418
source : AC2

21) chain A
residue 73
type
ligand
sequence Y
description binding site for residue CUY A 418
source : AC2

22) chain A
residue 84
type
ligand
sequence F
description binding site for residue CUY A 418
source : AC2

23) chain A
residue 88
type
ligand
sequence F
description binding site for residue CUY A 418
source : AC2

24) chain A
residue 90
type
ligand
sequence M
description binding site for residue CUY A 418
source : AC2

25) chain A
residue 96
type
ligand
sequence I
description binding site for residue CUY A 418
source : AC2

26) chain A
residue 98
type
ligand
sequence G
description binding site for residue CUY A 418
source : AC2

27) chain A
residue 100
type
ligand
sequence A
description binding site for residue CUY A 418
source : AC2

28) chain A
residue 116
type
ligand
sequence G
description binding site for residue CUY A 418
source : AC2

29) chain A
residue 123
type
ligand
sequence F
description binding site for residue CUY A 418
source : AC2

30) chain A
residue 148
type
ligand
sequence I
description binding site for residue CUY A 418
source : AC2

31) chain A
residue 40
type
ligand
sequence W
description binding site for residue CL A 419
source : AC3

32) chain A
residue 191
type
ligand
sequence L
description binding site for residue CL A 420
source : AC4

33) chain A
residue 115
type
ligand
sequence R
description binding site for residue CL A 421
source : AC5

34) chain A
residue 122
type
ligand
sequence D
description binding site for residue CL A 421
source : AC5

35) chain B
residue 60
type
ligand
sequence K
description binding site for residue CL A 421
source : AC5

36) chain A
residue 71
type
ligand
sequence R
description binding site for residue CL A 423
source : AC6

37) chain A
residue 228
type
ligand
sequence Q
description binding site for residue CL A 423
source : AC6

38) chain A
residue 93
type
ligand
sequence P
description binding site for residue EDO A 425
source : AC7

39) chain A
residue 94
type
ligand
sequence F
description binding site for residue EDO A 425
source : AC7

40) chain B
residue 34
type
ligand
sequence P
description binding site for residue EDO A 425
source : AC7

41) chain A
residue 105
type
ligand
sequence H
description binding site for residue NA A 427
source : AC9

42) chain A
residue 278
type
ligand
sequence R
description binding site for residue IOD A 428
source : AD1

43) chain A
residue 214
type
ligand
sequence K
description binding site for residue IOD A 429
source : AD2

44) chain B
residue 45
type
ligand
sequence G
description binding site for residue CL B 201
source : AD3

45) chain B
residue 81
type
ligand
sequence A
description binding site for residue CL B 201
source : AD3

46) chain A
residue 179
type
ligand
sequence A
description binding site for residue EDO B 202
source : AD4

47) chain B
residue 88
type
ligand
sequence T
description binding site for residue EDO B 202
source : AD4

48) chain B
residue 89
type
ligand
sequence L
description binding site for residue EDO B 202
source : AD4

49) chain B
residue 90
type
ligand
sequence S
description binding site for residue EDO B 202
source : AD4

50) chain B
residue 91
type
ligand
sequence Q
description binding site for residue EDO B 202
source : AD4

51) chain A
residue 19
type
ligand
sequence T
description binding site for Poly-Saccharide residues NAG A 408 through FUC A 411 bound to ASN A 20
source : AD5

52) chain A
residue 20
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG A 408 through FUC A 411 bound to ASN A 20
source : AD5

53) chain A
residue 23
type
ligand
sequence W
description binding site for Poly-Saccharide residues NAG A 408 through FUC A 411 bound to ASN A 20
source : AD5

54) chain A
residue 271
type
ligand
sequence Q
description binding site for Poly-Saccharide residues NAG A 408 through FUC A 411 bound to ASN A 20
source : AD5

55) chain A
residue 43
type
ligand
sequence D
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

56) chain A
residue 57
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

57) chain A
residue 58
type
ligand
sequence F
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

58) chain A
residue 168
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

59) chain A
residue 171
type
ligand
sequence L
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

60) chain A
residue 221
type
ligand
sequence M
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

61) chain A
residue 222
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

62) chain A
residue 223
type
ligand
sequence G
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

63) chain A
residue 255
type
ligand
sequence E
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

64) chain A
residue 257
type
ligand
sequence A
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

65) chain A
residue 258
type
ligand
sequence G
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

66) chain A
residue 260
type
ligand
sequence S
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

67) chain A
residue 276
type
ligand
sequence Y
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

68) chain A
residue 280
type
ligand
sequence S
description binding site for Poly-Saccharide residues NAG A 401 through MAN A 407 bound to ASN A 57
source : AD6

69) chain A
residue 128
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG A 412 through MAN A 416 bound to ASN A 128
source : AD7

70) chain A
residue 201
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG A 412 through MAN A 416 bound to ASN A 128
source : AD7

71) chain A
residue 203
type
ligand
sequence Q
description binding site for Poly-Saccharide residues NAG A 412 through MAN A 416 bound to ASN A 128
source : AD7

72) chain A
residue 246
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG A 412 through MAN A 416 bound to ASN A 128
source : AD7

73) chain A
residue 10
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence F
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

74) chain A
residue 12
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence V
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

75) chain A
residue 38
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence H
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

76) chain A
residue 54-55
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence SK
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

77) chain A
residue 58
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence F
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

78) chain A
residue 63
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence V
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

79) chain A
residue 66
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence L
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

80) chain A
residue 68-70
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence EIF
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

81) chain A
residue 72-73
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence VY
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

82) chain A
residue 76-77
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence GF
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

83) chain A
residue 79-80
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence RE
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

84) chain A
residue 100-101
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence AG
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

85) chain A
residue 114
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence L
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

86) chain A
residue 124
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence L
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

87) chain A
residue 126
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence V
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

88) chain A
residue 129-131
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence ASC
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

89) chain A
residue 144
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence F
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

90) chain A
residue 148-149
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence II
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

91) chain A
residue 152-155
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence QGIM
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

92) chain A
residue 157-158
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence TV
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

93) chain A
residue 161-162
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence LL
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

94) chain A
residue 165-166
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence TC
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

95) chain A
residue 169
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence Y
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6d64_A_417

96) chain A
residue 12-14
type binding
ligand CUY: tetracosyl octadecanoate
sequence VIQ
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

97) chain A
residue 28-30
type binding
ligand CUY: tetracosyl octadecanoate
sequence GSG
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

98) chain A
residue 38-40
type binding
ligand CUY: tetracosyl octadecanoate
sequence HGW
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

99) chain A
residue 47
type binding
ligand CUY: tetracosyl octadecanoate
sequence A
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

100) chain A
residue 49
type binding
ligand CUY: tetracosyl octadecanoate
sequence F
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

101) chain A
residue 63
type binding
ligand CUY: tetracosyl octadecanoate
sequence V
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

102) chain A
residue 66-67
type binding
ligand CUY: tetracosyl octadecanoate
sequence LE
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

103) chain A
residue 70
type binding
ligand CUY: tetracosyl octadecanoate
sequence F
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

104) chain A
residue 73-74
type binding
ligand CUY: tetracosyl octadecanoate
sequence YI
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

105) chain A
residue 77
type binding
ligand CUY: tetracosyl octadecanoate
sequence F
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

106) chain A
residue 80-81
type binding
ligand CUY: tetracosyl octadecanoate
sequence EV
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

107) chain A
residue 84-85
type binding
ligand CUY: tetracosyl octadecanoate
sequence FA
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

108) chain A
residue 88
type binding
ligand CUY: tetracosyl octadecanoate
sequence F
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

109) chain A
residue 90
type binding
ligand CUY: tetracosyl octadecanoate
sequence M
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

110) chain A
residue 96-100
type binding
ligand CUY: tetracosyl octadecanoate
sequence IQGIA
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

111) chain A
residue 114-118
type binding
ligand CUY: tetracosyl octadecanoate
sequence LRGAL
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

112) chain A
residue 123-124
type binding
ligand CUY: tetracosyl octadecanoate
sequence FL
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

113) chain A
residue 140
type binding
ligand CUY: tetracosyl octadecanoate
sequence R
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

114) chain A
residue 144
type binding
ligand CUY: tetracosyl octadecanoate
sequence F
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

115) chain A
residue 147-148
type binding
ligand CUY: tetracosyl octadecanoate
sequence LI
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

116) chain A
residue 151
type binding
ligand CUY: tetracosyl octadecanoate
sequence Y
description tetracosyl octadecanoate binding site
source pdb_hetatom : CUY_6d64_A_418

117) chain A
residue 19-20
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_408

118) chain A
residue 22-23
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TW
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_408

119) chain A
residue 19
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence T
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_6d64_A_409

120) chain A
residue 23
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence W
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_6d64_A_409

121) chain A
residue 25
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence Q
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_6d64_A_409

122) chain B
residue 36
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence D
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_6d64_A_409

123) chain A
residue 21-22
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence ST
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6d64_A_426

124) chain A
residue 57-58
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NF
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_401

125) chain A
residue 62
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_401

126) chain A
residue 168
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_401

127) chain A
residue 171-172
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence LG
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_401

128) chain A
residue 93-95
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence PFE
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6d64_A_425

129) chain B
residue 34
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence P
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6d64_A_425

130) chain A
residue 110
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence I
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_404

131) chain A
residue 167-168
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence PR
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_404

132) chain A
residue 171
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_404

133) chain A
residue 128
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d64_A_412

134) chain A
residue 168
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence R
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_6d64_A_403

135) chain A
residue 171
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence L
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_6d64_A_402

136) chain A
residue 175
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence N
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_6d64_A_402

137) chain B
residue 88-91
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence TLSQ
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6d64_B_202

138) chain B
residue 93
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence K
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6d64_B_202


Display surface

Download
Links