eF-site ID 6d2p-L
PDB Code 6d2p
Chain L

click to enlarge
Title Crystal structure of IOMA-class CLK31 Fab from an HIV-1 naive donor in complex with a germline-targeting gp120 engineered outer domain eOD-GT8 at 2.6 A
Classification IMMUNE SYSTEM
Compound Germline-targeting HIV-1 gp120 engineered outer domain eOD-GT8
Source (6D2P)
Sequence L:  SALTQPASVSGSPGQSITISCTGTSSDVGSNLVSWYQQHP
GKAPKLMIYEGSKRPSGVSNRFSGSKSGNTASLTISGLQA
EDEADYYCCSYAGSVVFGGGTKLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVE
TTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS
TVEKTVAPTE
Description (1)  VRC01cHuGL2 Fab heavy chain, VRC01c-HuGL2 Fab light chain, Germline-targeting HIV-1 gp120 engineered outer domain eOD-GT8

Display surface

Download
Links