eF-site ID 6d2e-A
PDB Code 6d2e
Chain A

click to enlarge
Title Crystal structure of Corynebacterium diphtheriae UDP-galactopyranose mutase in complex with UDP-galactopyranose (open, oxidized)
Classification ISOMERASE
Compound UDP-galactopyranose mutase
Source (A0A246CDW5_CORDP)
Sequence A:  SDFDLIVVGSGLFGLTVAERAASQLGKKVLIVEKRSHLGG
NAYSEAEPETGIEIHKYGAHLFHTSNKRVWDYVNQFTAFT
GYQHRVFAMHNGTAYQFPMGLGLINQFFGRYYTPDEAREL
IKEQSAEIDSKDATNLEEKAISLIGRPLYEAFIRDYTAKQ
WQTDPKELPAGNITRLPVRYNFDNRYFNDTYEGLPVDGYA
QWLSNMADHENIEVRLDTDWFEVREDLRAQNPEAPVVYTG
PLDRYFDYSEGHLGWRTLDFETEVLNTGDFQGTPVMNYND
AEFPYTRIHEFRHFHPEREDRHPKDKTVIMKEYSRFAEEG
DEPYYPINTPSDREMLFKYRELADAETESGKVYFGGRLGT
YQYLDMHMAIASALSMFDNKLVDALK
Description (1)  UDP-galactopyranose mutase


Functional site

1) chain A
residue 9
type
ligand
sequence V
description binding site for residue FAD A 401
source : AC1

2) chain A
residue 10
type
ligand
sequence G
description binding site for residue FAD A 401
source : AC1

3) chain A
residue 12
type
ligand
sequence G
description binding site for residue FAD A 401
source : AC1

4) chain A
residue 13
type
ligand
sequence L
description binding site for residue FAD A 401
source : AC1

5) chain A
residue 14
type
ligand
sequence F
description binding site for residue FAD A 401
source : AC1

6) chain A
residue 33
type
ligand
sequence V
description binding site for residue FAD A 401
source : AC1

7) chain A
residue 34
type
ligand
sequence E
description binding site for residue FAD A 401
source : AC1

8) chain A
residue 35
type
ligand
sequence K
description binding site for residue FAD A 401
source : AC1

9) chain A
residue 36
type
ligand
sequence R
description binding site for residue FAD A 401
source : AC1

10) chain A
residue 41
type
ligand
sequence G
description binding site for residue FAD A 401
source : AC1

11) chain A
residue 42
type
ligand
sequence N
description binding site for residue FAD A 401
source : AC1

12) chain A
residue 58
type
ligand
sequence Y
description binding site for residue FAD A 401
source : AC1

13) chain A
residue 60
type
ligand
sequence A
description binding site for residue FAD A 401
source : AC1

14) chain A
residue 61
type
ligand
sequence H
description binding site for residue FAD A 401
source : AC1

15) chain A
residue 62
type
ligand
sequence L
description binding site for residue FAD A 401
source : AC1

16) chain A
residue 219
type
ligand
sequence T
description binding site for residue FAD A 401
source : AC1

17) chain A
residue 220
type
ligand
sequence D
description binding site for residue FAD A 401
source : AC1

18) chain A
residue 221
type
ligand
sequence W
description binding site for residue FAD A 401
source : AC1

19) chain A
residue 222
type
ligand
sequence F
description binding site for residue FAD A 401
source : AC1

20) chain A
residue 241
type
ligand
sequence G
description binding site for residue FAD A 401
source : AC1

21) chain A
residue 242
type
ligand
sequence P
description binding site for residue FAD A 401
source : AC1

22) chain A
residue 259
type
ligand
sequence L
description binding site for residue FAD A 401
source : AC1

23) chain A
residue 325
type
ligand
sequence Y
description binding site for residue FAD A 401
source : AC1

24) chain A
residue 326
type
ligand
sequence Y
description binding site for residue FAD A 401
source : AC1

25) chain A
residue 357
type
ligand
sequence G
description binding site for residue FAD A 401
source : AC1

26) chain A
residue 358
type
ligand
sequence R
description binding site for residue FAD A 401
source : AC1

27) chain A
residue 364
type
ligand
sequence Y
description binding site for residue FAD A 401
source : AC1

28) chain A
residue 365
type
ligand
sequence L
description binding site for residue FAD A 401
source : AC1

29) chain A
residue 366
type
ligand
sequence D
description binding site for residue FAD A 401
source : AC1

30) chain A
residue 367
type
ligand
sequence M
description binding site for residue FAD A 401
source : AC1

31) chain A
residue 370
type
ligand
sequence A
description binding site for residue FAD A 401
source : AC1

32) chain A
residue 64
type
ligand
sequence H
description binding site for residue GDU A 402
source : AC2

33) chain A
residue 98
type
ligand
sequence F
description binding site for residue GDU A 402
source : AC2

34) chain A
residue 153
type
ligand
sequence F
description binding site for residue GDU A 402
source : AC2

35) chain A
residue 154
type
ligand
sequence I
description binding site for residue GDU A 402
source : AC2

36) chain A
residue 157
type
ligand
sequence Y
description binding site for residue GDU A 402
source : AC2

37) chain A
residue 158
type
ligand
sequence T
description binding site for residue GDU A 402
source : AC2

38) chain A
residue 161
type
ligand
sequence Q
description binding site for residue GDU A 402
source : AC2

39) chain A
residue 187
type
ligand
sequence Y
description binding site for residue GDU A 402
source : AC2

40) chain A
residue 278
type
ligand
sequence N
description binding site for residue GDU A 402
source : AC2

41) chain A
residue 280
type
ligand
sequence N
description binding site for residue GDU A 402
source : AC2

42) chain A
residue 288
type
ligand
sequence R
description binding site for residue GDU A 402
source : AC2

43) chain A
residue 326
type
ligand
sequence Y
description binding site for residue GDU A 402
source : AC2

44) chain A
residue 366
type
ligand
sequence D
description binding site for residue GDU A 402
source : AC2

45) chain A
residue 126
type
ligand
sequence S
description binding site for residue NA A 403
source : AC3

46) chain A
residue 129
type
ligand
sequence I
description binding site for residue NA A 403
source : AC3

47) chain A
residue 143
type
ligand
sequence S
description binding site for residue NA A 403
source : AC3

48) chain A
residue 109
type
ligand
sequence F
description binding site for residue IPA A 404
source : AC4

49) chain A
residue 75
type
ligand
sequence N
description binding site for residue IPA A 405
source : AC5

50) chain A
residue 271
type
ligand
sequence F
description binding site for residue IPA A 406
source : AC6

51) chain A
residue 312
type
ligand
sequence K
description binding site for residue IPA A 406
source : AC6

52) chain A
residue 262
type
ligand
sequence E
description binding site for residue IPA A 407
source : AC7

53) chain A
residue 56
type
ligand
sequence H
description binding site for residue IPA A 408
source : AC8

54) chain A
residue 61
type
ligand
sequence H
description binding site for residue IPA A 408
source : AC8

55) chain A
residue 200
type
ligand
sequence Y
description binding site for residue IPA A 408
source : AC8

56) chain A
residue 295
type
ligand
sequence F
description binding site for residue IPA A 408
source : AC8

57) chain A
residue 9-15
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence VGSGLFG
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

58) chain A
residue 33-36
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence VEKR
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

59) chain A
residue 40-43
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence GGNA
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

60) chain A
residue 58-64
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence YGAHLFH
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

61) chain A
residue 219-222
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence TDWF
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

62) chain A
residue 239-242
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence YTGP
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

63) chain A
residue 259
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence L
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

64) chain A
residue 261
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence F
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

65) chain A
residue 325-326
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence YY
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

66) chain A
residue 356-359
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence GGRL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

67) chain A
residue 364-368
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence YLDMH
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

68) chain A
residue 370
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence A
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_6d2e_A_401

69) chain A
residue 54
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence E
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_408

70) chain A
residue 56
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence H
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_408

71) chain A
residue 60-62
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence AHL
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_408

72) chain A
residue 195
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence L
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_408

73) chain A
residue 200
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence Y
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_408

74) chain A
residue 292
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence F
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_408

75) chain A
residue 295-296
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence FH
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_408

76) chain A
residue 60
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence A
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

77) chain A
residue 62
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence L
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

78) chain A
residue 64
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence H
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

79) chain A
residue 89
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence A
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

80) chain A
residue 98
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence F
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

81) chain A
residue 153-154
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence FI
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

82) chain A
residue 157-158
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence YT
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

83) chain A
residue 161-162
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence QW
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

84) chain A
residue 187-188
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence YF
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

85) chain A
residue 278
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence N
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

86) chain A
residue 280
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence N
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

87) chain A
residue 288
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence R
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

88) chain A
residue 326
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence Y
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

89) chain A
residue 364
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence Y
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

90) chain A
residue 366
type binding
ligand GDU: GALACTOSE-URIDINE-5'-DIPHOSPHATE
sequence D
description GALACTOSE-URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDU_6d2e_A_402

91) chain A
residue 75-79
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence NQFTA
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_405

92) chain A
residue 108-109
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence FF
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_404

93) chain A
residue 148
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence P
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_404

94) chain A
residue 260
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence D
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_407

95) chain A
residue 262
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence E
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_407

96) chain A
residue 314
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence Y
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_407

97) chain A
residue 264
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence E
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_406

98) chain A
residue 266
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence L
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_406

99) chain A
residue 271
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence F
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_406

100) chain A
residue 286
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence Y
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_406

101) chain A
residue 310
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence I
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_406

102) chain A
residue 312
type binding
ligand IPA: ISOPROPYL ALCOHOL
sequence K
description ISOPROPYL ALCOHOL binding site
source pdb_hetatom : IPA_6d2e_A_406


Display surface

Download
Links